NECTIN3 blocking peptide

NECTIN3 Peptide - middle region

Cat. Num. AAA3231347

• Gene Names: NECTIN3; PPR3; PRR3; CD113; PVRL3; PVRR3; CDW113; NECTIN-3
• Reactivity: Human
• Applications: Western Blot
• Synonyms: NECTIN3; NECTIN3 Peptide - middle region; NECTIN3 blocking peptide

• Reactivity: Human
• Form/Format: Lyophilized powder
• Sequence: PDSVKKENKNPVNNLIRKDYLEEPEKTQWNNVENLNRFERPMDYYEDLKM
• Sequence Length: 549

• Applicable Applications for NECTIN3 blocking peptide: Western Blot (WB)
• Preparation and Storage: Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Related Product Information for NECTIN3 blocking peptide

This gene encodes a member of the nectin family of proteins, which function as adhesion molecules at adherens junctions. This family member interacts with other nectin-like proteins and with afadin, a filamentous actin-binding protein involved in the regulation of directional motility, cell proliferation and survival. This gene plays a role in ocular development involving the ciliary body. Mutations in this gene are believed to result in congenital ocular defects. Alternative splicing results in multiple transcript variants.

Product Categories/Family for NECTIN3 blocking peptide

Peptide

NCBI and Uniprot Product Information

• NCBI GI #: 11386199
• NCBI GeneID: 25945
• NCBI Accession #: NP_056295
• NCBI GenBank Nucleotide #: NM_015480
• UniProt Accession #: Q9NQS3
• Molecular Weight: 61kDa
• NCBI Official Full Name: nectin-3 isoform 1
• NCBI Official Synonym Full Names: nectin cell adhesion molecule 3
• NCBI Official Symbol: NECTIN3
• NCBI Official Synonym Symbols: PPR3; PRR3; CD113; PVRL3; PVRR3; CDW113; NECTIN-3
• NCBI Protein Information: nectin-3
• UniProt Protein Name: Poliovirus receptor-related protein 3
• Protein Family: Nectin
• UniProt Gene Name: PVRL3
• UniProt Synonym Gene Names: PRR3
• UniProt Entry Name: PVRL3_HUMAN

NCBI Description

This gene encodes a member of the nectin family of proteins, which function as adhesion molecules at adherens junctions. This family member interacts with other nectin-like proteins and with afadin, a filamentous actin-binding protein involved in the regulation of directional motility, cell proliferation and survival. This gene plays a role in ocular development involving the ciliary body. Mutations in this gene are believed to result in congenital ocular defects. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2011]

Uniprot Description

PVRL3: Plays a role in cell-cell adhesion through heterophilic trans-interactions with nectin-like proteins or nectins, such as trans-interaction with PVRL2/nectin-2 at Sertoli-spermatid junctions. Trans-interaction with PVR induces activation of CDC42 and RAC small G proteins through common signaling molecules such as SRC and RAP1. Also involved in the formation of cell-cell junctions, including adherens junctions and synapses. Induces endocytosis-mediated down-regulation of PVR from the cell surface, resulting in reduction of cell movement and proliferation. Plays a role in the morphology of the ciliary body. Belongs to the nectin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell adhesion; Membrane protein, integral

Chromosomal Location of Human Ortholog: 3q13

Cellular Component: apical junction complex; postsynaptic membrane; cell-cell adherens junction; plasma membrane; integral to membrane

Molecular Function: protein binding; protein homodimerization activity; cell adhesion molecule binding

Biological Process: intercellular junction assembly and maintenance; cell-cell adhesion; fertilization; lens morphogenesis in camera-type eye; homophilic cell adhesion; retina morphogenesis in camera-type eye