Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

MC2R blocking peptide

MC2R Peptide - N-terminal region

Gene Names
MC2R; ACTHR
Reactivity
Human
Applications
Western Blot
Synonyms
MC2R; MC2R Peptide - N-terminal region; MC2R blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
LRNMGYLKPRGSFETTADDIIDSLFVLSLLGSIFSLSVIAADRYITIFHA
Sequence Length
297
Applicable Applications for MC2R blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for MC2R blocking peptide
This is a synthetic peptide designed for use in combination with anti-MC2R Antibody, made

Target Description: MC2R encodes one member of the five-member G-protein associated melanocortin receptor family. Melanocortins (melanocyte-stimulating hormones and adrenocorticotropic hormone) are peptides derived from pro-opiomelanocortin (POMC). MC2R is selectively activated by adrenocorticotropic hormone, whereas the other four melanocortin receptors recognize a variety of melanocortin ligands. Mutations in MC2R can result in familial glucocorticoid deficiency.
Product Categories/Family for MC2R blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33kDa
NCBI Official Full Name
adrenocorticotropic hormone receptor
NCBI Official Synonym Full Names
melanocortin 2 receptor
NCBI Official Symbol
MC2R
NCBI Official Synonym Symbols
ACTHR
NCBI Protein Information
adrenocorticotropic hormone receptor
UniProt Protein Name
Adrenocorticotropic hormone receptor
UniProt Gene Name
MC2R
UniProt Synonym Gene Names
ACTHR; ACTH receptor; ACTH-R; MC2-R
UniProt Entry Name
ACTHR_HUMAN

NCBI Description

MC2R encodes one member of the five-member G-protein associated melanocortin receptor family. Melanocortins (melanocyte-stimulating hormones and adrenocorticotropic hormone) are peptides derived from pro-opiomelanocortin (POMC). MC2R is selectively activated by adrenocorticotropic hormone, whereas the other four melanocortin receptors recognize a variety of melanocortin ligands. Mutations in MC2R can result in familial glucocorticoid deficiency. Alternate transcript variants have been found for this gene. [provided by RefSeq, May 2014]

Uniprot Description

MC2R: Receptor for ACTH. This receptor is mediated by G proteins (G(s)) which activate adenylate cyclase. Defects in MC2R are the cause of glucocorticoid deficiency type 1 (GCCD1); also known as familial glucocorticoid deficiency type 1 (FGD1). GCCD1 is an autosomal recessive disorder due to congenital insensitivity or resistance to adrenocorticotropin (ACTH). It is characterized by progressive primary adrenal insufficiency, without mineralocorticoid deficiency. Belongs to the G-protein coupled receptor 1 family.

Protein type: Receptor, GPCR; Membrane protein, integral; Membrane protein, multi-pass; GPCR, family 1

Chromosomal Location of Human Ortholog: 18p11.2

Cellular Component: integral to plasma membrane; cytoplasm; plasma membrane

Molecular Function: protein binding; melanocortin receptor activity; adrenocorticotropin receptor activity

Biological Process: G-protein coupled receptor protein signaling pathway; G-protein signaling, coupled to cyclic nucleotide second messenger; neuropeptide signaling pathway; positive regulation of cAMP biosynthetic process; placenta development

Disease: Glucocorticoid Deficiency 1

Research Articles on MC2R

Similar Products

Product Notes

The MC2R mc2r (Catalog #AAA3241021) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The MC2R Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MC2R can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MC2R mc2r for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LRNMGYLKPR GSFETTADDI IDSLFVLSLL GSIFSLSVIA ADRYITIFHA. It is sometimes possible for the material contained within the vial of "MC2R, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.