Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of MC2 receptor expression in mouse brain extract (lane 1). MC2 receptor at 39KD was detected using rabbit anti- MC2 receptor Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Rabbit anti-Mouse MC2 Receptor Polyclonal Antibody | anti-MC2R antibody

Anti-MC2 Receptor Antibody

Gene Names
MC2R; ACTHR
Reactivity
Mouse
Applications
Western Blot
Purity
Immunogen affinity purified.
Synonyms
MC2 Receptor; Polyclonal Antibody; Anti-MC2 Receptor Antibody; ACTH receptor; ACTH-R; ACTHR; MC2 receptor; MC2-R; MC2R; Q01718; Adrenocorticotropic hormone receptor; melanocortin 2 receptor; anti-MC2R antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
297
Applicable Applications for anti-MC2R antibody
Western Blot (WB)
Application Notes
Western Blot: 0.1-0.5ug/ml
Notes
Tested Species: In-house tested species with positive results.
Predicted Species: Species predicted to be fit for the product based on sequence similarities.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human MC2 receptor (268-297aa NAVIDPFIYAFRSPELRDAFKKMIFCSRYW), different from the related mouse sequence by four amino acids.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of MC2 receptor expression in mouse brain extract (lane 1). MC2 receptor at 39KD was detected using rabbit anti- MC2 receptor Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Western Blot (WB) (Western blot analysis of MC2 receptor expression in mouse brain extract (lane 1). MC2 receptor at 39KD was detected using rabbit anti- MC2 receptor Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )
Related Product Information for anti-MC2R antibody
Rabbit IgG polyclonal antibody for Adrenocorticotropic hormone receptor(MC2R) detection.
Background: Melanocortin-2 receptor (MC2R), also known as ACTH receptor (ACTHR), is a member of the G protein-coupled receptor family. This gene is mapped to 18p11.2. MC2R is selectively activated by adrenocorticotropic hormone, whereas the other four melanocortin receptors recognize a variety of melanocortin ligands. Mutations in MC2R can result in familial glucocorticoid deficiency. Alternate transcript variants have been found for this gene.
References
1. Chida, D., Nakagawa, S., Nagai, S., Sagara, H., Katsumata, H., Imaki, T., Suzuki, H., Mitani, F., Ogishima, T., Shimizu, C., Kotaki, H., Kakuta, S., Sudo, K., Koike, T., Kubo, M., Iwakura, Y. Melanocortin 2 receptor is required for adrenal gland development, steroidogenesis, and neonatal gluconeogenesis. Proc. Nat. Acad. Sci. 104: 18205-18210, 2007.
2. Naville, D., Jaillard, C., Barjhoux, L., Durand, P., Begeot, M. Genomic structure and promoter characterization of the human ACTH receptor gene. Biochem. Biophys. Res. Commun. 230: 7-12, 1997.
3. Vamvakopoulos, N. C., Rojas, K., Overhauser, J., Durkin, A. S., Nierman, W. C., Chrousos, G. P. Mapping the human melanocortin 2 receptor (adrenocorticotropic hormone receptor; ACTHR) gene (MC2R) to the small arm of chromosome 18 (18p11.21-pter). Genomics 18: 454-455, 1993.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33,927 Da
NCBI Official Full Name
adrenocorticotropic hormone receptor
NCBI Official Synonym Full Names
melanocortin 2 receptor
NCBI Official Symbol
MC2R
NCBI Official Synonym Symbols
ACTHR
NCBI Protein Information
adrenocorticotropic hormone receptor
UniProt Protein Name
Adrenocorticotropic hormone receptor
UniProt Gene Name
MC2R
UniProt Synonym Gene Names
ACTHR; ACTH receptor; ACTH-R; MC2-R

NCBI Description

MC2R encodes one member of the five-member G-protein associated melanocortin receptor family. Melanocortins (melanocyte-stimulating hormones and adrenocorticotropic hormone) are peptides derived from pro-opiomelanocortin (POMC). MC2R is selectively activated by adrenocorticotropic hormone, whereas the other four melanocortin receptors recognize a variety of melanocortin ligands. Mutations in MC2R can result in familial glucocorticoid deficiency. Alternate transcript variants have been found for this gene. [provided by RefSeq, May 2014]

Uniprot Description

MC2R: Receptor for ACTH. This receptor is mediated by G proteins (G(s)) which activate adenylate cyclase. Defects in MC2R are the cause of glucocorticoid deficiency type 1 (GCCD1); also known as familial glucocorticoid deficiency type 1 (FGD1). GCCD1 is an autosomal recessive disorder due to congenital insensitivity or resistance to adrenocorticotropin (ACTH). It is characterized by progressive primary adrenal insufficiency, without mineralocorticoid deficiency. Belongs to the G-protein coupled receptor 1 family.

Protein type: GPCR, family 1; Membrane protein, integral; Membrane protein, multi-pass; Receptor, GPCR

Chromosomal Location of Human Ortholog: 18p11.21

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function: melanocortin receptor activity; protein binding

Biological Process: G-protein coupled receptor protein signaling pathway; G-protein signaling, coupled to cyclic nucleotide second messenger; positive regulation of cAMP biosynthetic process

Disease: Glucocorticoid Deficiency 1

Research Articles on MC2R

Similar Products

Product Notes

The MC2R mc2r (Catalog #AAA178665) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-MC2 Receptor Antibody reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's MC2 Receptor can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the MC2R mc2r for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MC2 Receptor, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.