Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

KLC2 blocking peptide

KLC2 Peptide - middle region

Reactivity
Human
Synonyms
KLC2; KLC2 Peptide - middle region; KLC2 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: EAAHTLEDCASRNRKQGLDPASQTKVVELLKDGSGRRGDRRSSRDMAGGA
Sequence Length
545
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for KLC2 blocking peptide
This is a synthetic peptide designed for use in combination with anti- KLC2 Antibody, made

Target Description: Kinesin is a molecular motor that generates ATP-dependent movement of vesicles and organelles along microtubules. Kinesin consists of 2 light chains, such as KLC2, and 2 heavy chains in a 1:1 stoichiometric ratio.
Product Categories/Family for KLC2 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59 kDa
NCBI Official Full Name
kinesin light chain 2 isoform 2
NCBI Official Synonym Full Names
kinesin light chain 2
NCBI Official Symbol
KLC2
NCBI Protein Information
kinesin light chain 2
UniProt Protein Name
Kinesin light chain 2
Protein Family
UniProt Gene Name
KLC2
UniProt Synonym Gene Names
KLC 2
UniProt Entry Name
KLC2_HUMAN

NCBI Description

The protein encoded by this gene is a light chain of kinesin, a molecular motor responsible for moving vesicles and organelles along microtubules. Defects in this gene are a cause of spastic paraplegia, optic atrophy, and neuropathy (SPOAN) syndrome. [provided by RefSeq, Mar 2016]

Uniprot Description

KLC2: Kinesin is a microtubule-associated force-producing protein that may play a role in organelle transport. The light chain may function in coupling of cargo to the heavy chain or in the modulation of its ATPase activity. Belongs to the kinesin light chain family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Motor; Microtubule-binding

Chromosomal Location of Human Ortholog: 11q13.2

Cellular Component: ciliary rootlet; microtubule; kinesin complex; neuron projection; protein complex; membrane; cytosol

Molecular Function: protein binding; kinesin binding; microtubule motor activity

Biological Process: metabolic process; axon cargo transport; antigen processing and presentation of exogenous peptide antigen via MHC class II; blood coagulation; microtubule-based movement

Research Articles on KLC2

Similar Products

Product Notes

The KLC2 klc2 (Catalog #AAA3246727) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The KLC2 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: EAAHTLEDCA SRNRKQGLDP ASQTKVVELL KDGSGRRGDR RSSRDMAGGA. It is sometimes possible for the material contained within the vial of "KLC2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.