Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-KLC2 AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole CellKLC2 is supported by BioGPS gene expression data to be expressed in MCF7)

Rabbit KLC2 Polyclonal Antibody | anti-KLC2 antibody

KLC2 antibody - C-terminal region

Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
KLC2; Polyclonal Antibody; KLC2 antibody - C-terminal region; anti-KLC2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SSEMLVKKLQGGTPQEPPNPRMKRASSLNFLNKSVEEPTQPGGTGLSDSR
Sequence Length
622
Applicable Applications for anti-KLC2 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Pig: 93%; Rat: 93%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-KLC2 AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole CellKLC2 is supported by BioGPS gene expression data to be expressed in MCF7)

Western Blot (WB) (WB Suggested Anti-KLC2 AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole CellKLC2 is supported by BioGPS gene expression data to be expressed in MCF7)
Related Product Information for anti-KLC2 antibody
This is a rabbit polyclonal antibody against KLC2. It was validated on Western Blot

Target Description: Kinesin is a molecular motor that generates ATP-dependent movement of vesicles and organelles along microtubules. Kinesin consists of 2 light chains, such as KLC2, and 2 heavy chains.
Product Categories/Family for anti-KLC2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
68kDa
NCBI Official Full Name
kinesin light chain 2 isoform 1
NCBI Official Synonym Full Names
kinesin light chain 2
NCBI Official Symbol
KLC2
NCBI Protein Information
kinesin light chain 2
UniProt Protein Name
Kinesin light chain 2
Protein Family
UniProt Gene Name
KLC2
UniProt Synonym Gene Names
KLC 2
UniProt Entry Name
KLC2_HUMAN

NCBI Description

The protein encoded by this gene is a light chain of kinesin, a molecular motor responsible for moving vesicles and organelles along microtubules. Defects in this gene are a cause of spastic paraplegia, optic atrophy, and neuropathy (SPOAN) syndrome. [provided by RefSeq, Mar 2016]

Uniprot Description

KLC2: Kinesin is a microtubule-associated force-producing protein that may play a role in organelle transport. The light chain may function in coupling of cargo to the heavy chain or in the modulation of its ATPase activity. Belongs to the kinesin light chain family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Motor; Microtubule-binding

Chromosomal Location of Human Ortholog: 11q13.2

Cellular Component: ciliary rootlet; microtubule; kinesin complex; neuron projection; protein complex; membrane; cytosol

Molecular Function: protein binding; kinesin binding; microtubule motor activity

Biological Process: metabolic process; axon cargo transport; antigen processing and presentation of exogenous peptide antigen via MHC class II; blood coagulation; microtubule-based movement

Research Articles on KLC2

Similar Products

Product Notes

The KLC2 klc2 (Catalog #AAA3215498) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KLC2 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's KLC2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KLC2 klc2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SSEMLVKKLQ GGTPQEPPNP RMKRASSLNF LNKSVEEPTQ PGGTGLSDSR. It is sometimes possible for the material contained within the vial of "KLC2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.