Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

KLC1 blocking peptide

KLC1 Peptide - C-terminal region

Gene Names
KLC1; KLC; KNS2; KNS2A
Reactivity
Human
Applications
Western Blot
Synonyms
KLC1; KLC1 Peptide - C-terminal region; KLC1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: ETLYKEILTRAHEREFGSVDDENKPIWMHAEEREECKGKQKDGTSFGEYG
Sequence Length
551
Applicable Applications for KLC1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for KLC1 blocking peptide
This is a synthetic peptide designed for use in combination with anti-KLC1 Antibody, made

Target Description: Conventional kinesin is a tetrameric molecule composed of two heavy chains and two light chains, and transports various cargos along microtubules toward their plus ends. The heavy chains provide the motor activity, while the light chains bind to various cargos. This gene encodes a member of the kinesin light chain family. It associates with kinesin heavy chain through an N-terminal domain, and six tetratricopeptide repeat (TPR) motifs are thought to be involved in binding of cargos such as vesicles, mitochondria, and the Golgi complex. Thus, kinesin light chains function as adapter molecules and not motors per se. Although previously named "kinesin 2", this gene is not a member of the kinesin-2 / kinesin heavy chain subfamily of kinesin motor proteins. Extensive alternative splicing produces isoforms with different C-termini that are proposed to bind to different cargos; however, the full-length nature and/or biological validity of most of these variants have not been determined.
Product Categories/Family for KLC1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60 kDa
NCBI Official Full Name
kinesin light chain 1 isoform 1
NCBI Official Synonym Full Names
kinesin light chain 1
NCBI Official Symbol
KLC1
NCBI Official Synonym Symbols
KLC; KNS2; KNS2A
NCBI Protein Information
kinesin light chain 1
UniProt Protein Name
Kinesin light chain 1
Protein Family
UniProt Gene Name
KLC1
UniProt Synonym Gene Names
KLC; KNS2
UniProt Entry Name
KLC1_HUMAN

NCBI Description

Conventional kinesin is a tetrameric molecule composed of two heavy chains and two light chains, and transports various cargos along microtubules toward their plus ends. The heavy chains provide the motor activity, while the light chains bind to various cargos. This gene encodes a member of the kinesin light chain family. It associates with kinesin heavy chain through an N-terminal domain, and six tetratricopeptide repeat (TPR) motifs are thought to be involved in binding of cargos such as vesicles, mitochondria, and the Golgi complex. Thus, kinesin light chains function as adapter molecules and not motors per se. Although previously named "kinesin 2", this gene is not a member of the kinesin-2 / kinesin heavy chain subfamily of kinesin motor proteins. Extensive alternative splicing produces isoforms with different C-termini that are proposed to bind to different cargos; however, the full-length nature and/or biological validity of most of these variants have not been determined. [provided by RefSeq, Jul 2008]

Uniprot Description

KLC1: a microtubule-associated force-producing protein that may play a role in organelle transport. The light chain may function in coupling of cargo to the heavy chain or in the modulation of its ATPase activity.

Protein type: Microtubule-binding; Motor

Chromosomal Location of Human Ortholog: 14q32.3

Cellular Component: ciliary rootlet; kinesin complex; microtubule; growth cone; membrane; cell soma; axon; cytoplasmic membrane-bound vesicle; cytosol

Molecular Function: tubulin binding; protein binding; motor activity; microtubule motor activity

Biological Process: intracellular protein transport; viral reproduction; metabolic process; axon cargo transport; antigen processing and presentation of exogenous peptide antigen via MHC class II; blood coagulation; microtubule-based movement

Research Articles on KLC1

Similar Products

Product Notes

The KLC1 klc1 (Catalog #AAA3240020) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The KLC1 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KLC1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KLC1 klc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ETLYKEILTR AHEREFGSVD DENKPIWMHA EEREECKGKQ KDGTSFGEYG. It is sometimes possible for the material contained within the vial of "KLC1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.