Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

KDM4A blocking peptide

KDM4A Peptide - middle region

Gene Names
KDM4A; JMJD2; JHDM3A; JMJD2A; TDRD14A
Reactivity
Human
Synonyms
KDM4A; KDM4A Peptide - middle region; KDM4A blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: AEVADEYMFSLEENKKSKGRRQPLSKLPRHHPLVLQECVSDDETSEQLTP
Sequence Length
481
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for KDM4A blocking peptide
This is a synthetic peptide designed for use in combination with anti- KDM4A Antibody, made

Target Description: This gene is a member of the Jumonji domain 2 (JMJD2) family and encodes a protein containing a JmjN domain, a JmjC domain, a JD2H domain, two TUDOR domains, and two PHD-type zinc fingers. This nuclear protein functions as a trimethylation-specific demethylase, converting specific trimethylated histone residues to the dimethylated form, and as a transcriptional repressor.
Product Categories/Family for KDM4A blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52 kDa
NCBI Official Full Name
lysine-specific demethylase 4A
NCBI Official Synonym Full Names
lysine demethylase 4A
NCBI Official Symbol
KDM4A
NCBI Official Synonym Symbols
JMJD2; JHDM3A; JMJD2A; TDRD14A
NCBI Protein Information
lysine-specific demethylase 4A
UniProt Protein Name
Lysine-specific demethylase 4A
UniProt Gene Name
KDM4A
UniProt Synonym Gene Names
JHDM3A; JMJD2; JMJD2A; KIAA0677
UniProt Entry Name
KDM4A_HUMAN

NCBI Description

This gene is a member of the Jumonji domain 2 (JMJD2) family and encodes a protein containing a JmjN domain, a JmjC domain, a JD2H domain, two TUDOR domains, and two PHD-type zinc fingers. This nuclear protein functions as a trimethylation-specific demethylase, converting specific trimethylated histone residues to the dimethylated form, and as a transcriptional repressor. [provided by RefSeq, Apr 2009]

Uniprot Description

JMJD2A: Histone demethylase that specifically demethylates 'Lys- 9' and 'Lys-36' residues of histone H3, thereby playing a central role in histone code. Does not demethylate histone H3 'Lys-4', H3 'Lys-27' nor H4 'Lys-20'. Demethylates trimethylated H3 'Lys-9' and H3 'Lys-36' residue, while it has no activity on mono- and dimethylated residues. Demethylation of Lys residue generates formaldehyde and succinate. Participates in transcriptional repression of ASCL2 and E2F-responsive promoters via the recruitment of histone deacetylases and NCOR1, respectively. Interacts with histone deacetylase proteins HDAC1, HDAC2 and HDAC3. Interacts with RB and NCOR1. Interacts with HTLV-1 Tax protein. Ubiquitous. Belongs to the JHDM3 histone demethylase family.

Protein type: Transcription, coactivator/corepressor; Demethylase; EC 1.14.11.-; Oxidoreductase

Chromosomal Location of Human Ortholog: 1p34.1

Cellular Component: nucleoplasm; cytoplasm; nucleolus; nucleus

Molecular Function: protein binding; zinc ion binding; ubiquitin protein ligase binding; histone demethylase activity (H3-K36 specific); methylated histone residue binding

Biological Process: cardiac muscle hypertrophy; histone demethylation; establishment and/or maintenance of chromatin architecture; transcription, DNA-dependent; viral reproduction; negative regulation of transcription, DNA-dependent

Research Articles on KDM4A

Similar Products

Product Notes

The KDM4A kdm4a (Catalog #AAA3248111) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The KDM4A Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: AEVADEYMFS LEENKKSKGR RQPLSKLPRH HPLVLQECVS DDETSEQLTP. It is sometimes possible for the material contained within the vial of "KDM4A, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.