Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

IL17RB blocking peptide

IL17RB Peptide - middle region

Gene Names
IL17RB; CRL4; EVI27; IL17BR; IL17RH1
Reactivity
Human
Synonyms
IL17RB; IL17RB Peptide - middle region; IL17RB blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: DCIRHKGTVVLCPQTGVPFPLDNNKSKPGGWLPLLLLSLLVATWVLVAGI
Sequence Length
55
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for IL17RB blocking peptide
This is a synthetic peptide designed for use in combination with anti- IL17RB Antibody, made

Target Description: The protein encoded by this gene is a cytokine receptor. This receptor specifically binds to IL17B and IL17E, but does not bind to IL17 and IL17C. This receptor has been shown to mediate the activation of NF-kappaB and the production of IL8 induced by IL17E. The expression of the rat counterpart of this gene was found to be significantly up-regulated during intestinal inflammation, which suggested the immunoregulatory activity of this receptor.
Product Categories/Family for IL17RB blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
502 kDa
NCBI Official Full Name
interleukin-17 receptor B
NCBI Official Synonym Full Names
interleukin 17 receptor B
NCBI Official Symbol
IL17RB
NCBI Official Synonym Symbols
CRL4; EVI27; IL17BR; IL17RH1
NCBI Protein Information
interleukin-17 receptor B
UniProt Protein Name
Interleukin-17 receptor B
Protein Family
UniProt Gene Name
IL17RB
UniProt Synonym Gene Names
CRL4; EVI27; IL17BR; IL-17 receptor B; IL-17RB; IL-17Rh1; IL17Rh1; IL-17B receptor
UniProt Entry Name
I17RB_HUMAN

NCBI Description

The protein encoded by this gene is a cytokine receptor. This receptor specifically binds to IL17B and IL17E, but does not bind to IL17 and IL17C. This receptor has been shown to mediate the activation of NF-kappaB and the production of IL8 induced by IL17E. The expression of the rat counterpart of this gene was found to be significantly up-regulated during intestinal inflammation, which suggested the immunoregulatory activity of this receptor. [provided by RefSeq, Jul 2008]

Uniprot Description

IL17RB: Receptor for the proinflammatory cytokines IL17B and IL17E. May play a role in controlling the growth and/or differentiation of hematopoietic cells. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 3p21.1

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function: interleukin-17 receptor activity

Biological Process: defense response

Research Articles on IL17RB

Similar Products

Product Notes

The IL17RB il17rb (Catalog #AAA3246535) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The IL17RB Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: DCIRHKGTVV LCPQTGVPFP LDNNKSKPGG WLPLLLLSLL VATWVLVAGI. It is sometimes possible for the material contained within the vial of "IL17RB, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.