Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

HNRNPU blocking peptide

HNRNPU Peptide - C-terminal region

Gene Names
HNRNPU; SAFA; HNRPU; SAF-A; U21.1; pp120; EIEE54; GRIP120; hnRNP U; HNRNPU-AS1
Reactivity
Human
Applications
Western Blot
Synonyms
HNRNPU; HNRNPU Peptide - C-terminal region; HNRNPU blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
EITYVELQKEEAQKLLEQYKEESKKALPPEKKQNTGSKKSNKNKSGKNQF
Sequence Length
825
Applicable Applications for HNRNPU blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for HNRNPU blocking peptide
This is a synthetic peptide designed for use in combination with anti-HNRNPU Antibody, made

Target Description: HNRNPU belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. HNRNPU contains a RNA binding domain and scaffold-associated region (SAR)-specific bipartite DNA-binding domain. This protein is also thought to be involved in the packaging of hnRNA into large ribonucleoprotein complexes. During apoptosis, this protein is cleaved in a caspase-dependent way. But this cleavage does not affect the function of the encoded protein in RNA metabolism.
Product Categories/Family for HNRNPU blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
90kDa
NCBI Official Full Name
heterogeneous nuclear ribonucleoprotein U isoform a
NCBI Official Synonym Full Names
heterogeneous nuclear ribonucleoprotein U
NCBI Official Symbol
HNRNPU
NCBI Official Synonym Symbols
SAFA; HNRPU; SAF-A; U21.1; pp120; EIEE54; GRIP120; hnRNP U; HNRNPU-AS1
NCBI Protein Information
heterogeneous nuclear ribonucleoprotein U
UniProt Protein Name
Heterogeneous nuclear ribonucleoprotein U
UniProt Gene Name
HNRNPU
UniProt Synonym Gene Names
HNRPU; SAFA; U21.1; hnRNP U; SAF-A
UniProt Entry Name
HNRPU_HUMAN

NCBI Description

This gene encodes a member of a family of proteins that bind nucleic acids and function in the formation of ribonucleoprotein complexes in the nucleus with heterogeneous nuclear RNA (hnRNA). The encoded protein has affinity for both RNA and DNA, and binds scaffold-attached region (SAR) DNA. Mutations in this gene have been associated with epileptic encephalopathy, early infantile, 54. A pseudogene of this gene has been identified on chromosome 14. [provided by RefSeq, Jun 2017]

Uniprot Description

hnRNP U: Component of the CRD-mediated complex that promotes MYC mRNA stabilization. Binds to pre-mRNA. Has high affinity for scaffold-attached region (SAR) DNA. Binds to double- and single- stranded DNA and RNA. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Spliceosome; Nuclear receptor co-regulator; RNA splicing; DNA-binding; RNA-binding

Chromosomal Location of Human Ortholog: 1q44

Cellular Component: nucleoplasm; cell surface; membrane; ribonucleoprotein complex; nucleus

Molecular Function: protein binding; DNA binding; RNA binding; ATP binding

Biological Process: RNA processing; nuclear mRNA splicing, via spliceosome; osteoblast differentiation; RNA splicing; gene expression; circadian regulation of gene expression

Research Articles on HNRNPU

Similar Products

Product Notes

The HNRNPU hnrnpu (Catalog #AAA3230256) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The HNRNPU Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HNRNPU can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HNRNPU hnrnpu for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: EITYVELQKE EAQKLLEQYK EESKKALPPE KKQNTGSKKS NKNKSGKNQF. It is sometimes possible for the material contained within the vial of "HNRNPU, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.