Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

HAUS7 blocking peptide

HAUS7 Peptide - N-terminal region

Gene Names
HAUS7; UIP1; UCHL5IP
Reactivity
Human
Applications
Western Blot
Synonyms
HAUS7; HAUS7 Peptide - N-terminal region; HAUS7 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: DLNCPFLEGLYITEPKTIQELLCSPSEYRLEILEWMCTRVWPSLQDRFSS
Sequence Length
338
Applicable Applications for HAUS7 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for HAUS7 blocking peptide
This is a synthetic peptide designed for use in combination with anti-HAUS7 Antibody, made

Target Description: This gene encodes a subunit of the augmin complex, which regulates centrosome and mitotic spindle integrity, and is necessary for the completion of cytokinesis. The encoded protein was identified by interaction with ubiquitin C-terminal hydrolase 37. Alternative splicing results in multiple transcript variants.
Product Categories/Family for HAUS7 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
HAUS augmin-like complex subunit 7
NCBI Official Synonym Full Names
HAUS augmin like complex subunit 7
NCBI Official Symbol
HAUS7
NCBI Official Synonym Symbols
UIP1; UCHL5IP
NCBI Protein Information
HAUS augmin-like complex subunit 7
UniProt Protein Name
HAUS augmin-like complex subunit 7
Protein Family
UniProt Gene Name
HAUS7
UniProt Synonym Gene Names
UCHL5IP; UIP1
UniProt Entry Name
HAUS7_HUMAN

NCBI Description

This gene encodes a subunit of the augmin complex, which regulates centrosome and mitotic spindle integrity, and is necessary for the completion of cytokinesis. The encoded protein was identified by interaction with ubiquitin C-terminal hydrolase 37. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2012]

Uniprot Description

HAUS7: Contributes to mitotic spindle assembly, maintenance of centrosome integrity and completion of cytokinesis as part of the HAUS augmin-like complex. Belongs to the HAUS7 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; Deoxyribonuclease; EC 3.1.11.2

Chromosomal Location of Human Ortholog: Xq28

Cellular Component: microtubule; centrosome; cytoplasm; plasma membrane; nucleolus; spindle

Molecular Function: thioesterase binding

Biological Process: mitosis; cell division; centrosome organization and biogenesis; spindle assembly

Research Articles on HAUS7

Similar Products

Product Notes

The HAUS7 haus7 (Catalog #AAA3238048) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The HAUS7 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HAUS7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HAUS7 haus7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DLNCPFLEGL YITEPKTIQE LLCSPSEYRL EILEWMCTRV WPSLQDRFSS. It is sometimes possible for the material contained within the vial of "HAUS7, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.