Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

GIPR blocking peptide

GIPR Peptide - N-terminal region

Gene Names
GIPR; PGQTL2
Reactivity
Human
Applications
Western Blot
Synonyms
GIPR; GIPR Peptide - N-terminal region; GIPR blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
GFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQVMYTVGYS
Sequence Length
466
Applicable Applications for GIPR blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for GIPR blocking peptide
This is a synthetic peptide designed for use in combination with anti-GIPR Antibody, made

Target Description: This gene encodes a G-protein coupled receptor for gastric inhibitory polypeptide (GIP), which was originally identified as an activity in gut extracts that inhibited gastric acid secretion and gastrin release, but subsequently was demonstrated to stimulate insulin release in the presence of elevated glucose. Mice lacking this gene exhibit higher blood glucose levels with impaired initial insulin response after oral glucose load. Defect in this gene thus may contribute to the pathogenesis of diabetes.
Product Categories/Family for GIPR blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53kDa
NCBI Official Full Name
gastric inhibitory polypeptide receptor isoform 1
NCBI Official Synonym Full Names
gastric inhibitory polypeptide receptor
NCBI Official Symbol
GIPR
NCBI Official Synonym Symbols
PGQTL2
NCBI Protein Information
gastric inhibitory polypeptide receptor
UniProt Protein Name
Gastric inhibitory polypeptide receptor
UniProt Gene Name
GIPR
UniProt Synonym Gene Names
GIP-R
UniProt Entry Name
GIPR_HUMAN

NCBI Description

This gene encodes a G-protein coupled receptor for gastric inhibitory polypeptide (GIP), which was originally identified as an activity in gut extracts that inhibited gastric acid secretion and gastrin release, but subsequently was demonstrated to stimulate insulin release in the presence of elevated glucose. Mice lacking this gene exhibit higher blood glucose levels with impaired initial insulin response after oral glucose load. Defect in this gene thus may contribute to the pathogenesis of diabetes. [provided by RefSeq, Oct 2011]

Uniprot Description

GIPR: This is a receptor for GIP. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. Belongs to the G-protein coupled receptor 2 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: GPCR, family 2; Receptor, GPCR; Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 19q13.3

Cellular Component: integral to membrane; plasma membrane

Molecular Function: gastric inhibitory peptide receptor activity; transmembrane receptor activity; peptide hormone binding

Biological Process: elevation of cytosolic calcium ion concentration; desensitization of G-protein coupled receptor protein signaling pathway; generation of precursor metabolites and energy; cell surface receptor linked signal transduction; adenylate cyclase activation; response to glucose stimulus; positive regulation of insulin secretion; response to axon injury; response to calcium ion; endocrine pancreas development; response to nutrient

Research Articles on GIPR

Similar Products

Product Notes

The GIPR gipr (Catalog #AAA3241127) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The GIPR Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GIPR can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GIPR gipr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GFVLRQCGSD GQWGLWRDHT QCENPEKNEA FLDQRLILER LQVMYTVGYS. It is sometimes possible for the material contained within the vial of "GIPR, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.