Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

GABARAPL1 blocking peptide

GABARAPL1 Peptide - middle region

Gene Names
GABARAPL1; ATG8; GEC1; APG8L; ATG8B; ATG8L; APG8-LIKE
Reactivity
Human
Applications
Western Blot
Synonyms
GABARAPL1; GABARAPL1 Peptide - middle region; GABARAPL1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: VIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFV
Sequence Length
146
Applicable Applications for GABARAPL1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for GABARAPL1 blocking peptide
This is a synthetic peptide designed for use in combination with anti-GABARAPL1 Antibody, made

Target Description: GABARAPL1 is a Ubiquitin-like modifier that increases cell-surface expression of kappa-type opioid receptor through facilitating anterograde intracellular trafficking of the receptor. it is involved in formation of autophagosomal vacuoles. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation.
Product Categories/Family for GABARAPL1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16kDa
NCBI Official Full Name
gamma-aminobutyric acid receptor-associated protein-like 1 isoform 2
NCBI Official Synonym Full Names
GABA type A receptor associated protein like 1
NCBI Official Symbol
GABARAPL1
NCBI Official Synonym Symbols
ATG8; GEC1; APG8L; ATG8B; ATG8L; APG8-LIKE
NCBI Protein Information
gamma-aminobutyric acid receptor-associated protein-like 1
UniProt Protein Name
Gamma-aminobutyric acid receptor-associated protein-like 1
UniProt Gene Name
GABARAPL1
UniProt Synonym Gene Names
GEC1; GEC-1
UniProt Entry Name
GBRL1_HUMAN

Uniprot Description

GABARAPL1: is a ubiquitin-like protein that is a constituent of the ATG8-conjugation system, one of two evolutionarily conserved phosphatidylethanolamine conjugation systems necessary for the formation of the autophagosome. The human ATG8 system includes seven ubiquitin-like light chain proteins (LCPs) that are homologs of yeast LC3: MAP1LC3A, -B, -C, GABARAP, GABARAPL1, -2, and -3. Pro-LCPs are cleaved by ATG4B to expose a C-terminal glycine residue, the cytosolic LCP-I form. The exposed C-terminus is conjugated to the head group amine of phosphatidylethanolamine (PE) through an amide bond by a sequence of ubiquitination-like reactions that involves an E1 (ATG7), an E2 (ATG3), and an E3 (a complex including ATG5, ATG12, and ATG16L). The PE-congugated form (LCP-II) is tightly associated with the autophagosomal membrane. The LCP-II forms can also be delipidated by the ATG4 proteases: most of the LCPs are delipidated and liberated from the membrane before autophagosomes fuse with lysosomes. Increases cell-surface expression of kappa-type opioid receptor through facilitating anterograde intracellular trafficking of the receptor. Belongs to the MAP1 LC3 family. Interacts with GABRG2 and beta-tubulin. Interacts with KOR-1.

Protein type: Vesicle; Autophagy; Ubiquitin-like modifier; Adaptor/scaffold; Microtubule-binding

Chromosomal Location of Human Ortholog: 12p13.2

Cellular Component: dendrite cytoplasm; Golgi apparatus; microtubule; extrinsic to membrane; cytoplasmic vesicle membrane; mitochondrion; endoplasmic reticulum; autophagic vacuole; intracellular; cytosol

Molecular Function: protein binding; Tat protein binding; microtubule binding; beta-tubulin binding; GABA receptor binding

Biological Process: mitochondrion degradation; autophagic vacuole formation

Research Articles on GABARAPL1

Similar Products

Product Notes

The GABARAPL1 gabarapl1 (Catalog #AAA3239041) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The GABARAPL1 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GABARAPL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GABARAPL1 gabarapl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VIVEKAPKAR VPDLDKRKYL VPSDLTVGQF YFLIRKRIHL RPEDALFFFV. It is sometimes possible for the material contained within the vial of "GABARAPL1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.