Gamma-aminobutyric acid receptor-associated protein-like 1 (GABARAPL1) Recombinant Protein | GABARAPL1 recombinant protein

Recombinant Human Gamma-aminobutyric acid receptor-associated protein-like 1 (GABARAPL1)

Cat. Num. AAA1444043

• Gene Names: GABARAPL1; ATG8; GEC1; APG8L; ATG8B; ATG8L; APG8-LIKE
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Gamma-aminobutyric acid receptor-associated protein-like 1 (GABARAPL1); Recombinant Human Gamma-aminobutyric acid receptor-associated protein-like 1 (GABARAPL1); Gamma-aminobutyric acid receptor-associated protein-like 1; Early estrogen-regulated protein; GABA(A) receptor-associated protein-like 1; Glandular epithelial cell protein 1; GEC-1; GABARAPL1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-117aa; Full Length
• Sequence: MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYG
• Sequence Length: 116

• Species: Homo sapiens (Human)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

Related Product Information for GABARAPL1 recombinant protein

Ubiquitin-like modifier that increases cell-surface expression of kappa-type opioid receptor through facilitating anterograde intracellular trafficking of the receptor. Involved in formation of autophagosomal vacuoles. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation.

Product Categories/Family for GABARAPL1 recombinant protein

Neuroscience

NCBI and Uniprot Product Information

• NCBI GI #: 13899219
• NCBI GeneID: 23710
• NCBI Accession #: NP_113600.1
• NCBI GenBank Nucleotide #: NM_031412.2
• UniProt Accession #: Q9H0R8; Q6FIE6; B4E0Y7
• Molecular Weight: 40.9 kDa
• NCBI Official Full Name: gamma-aminobutyric acid receptor-associated protein-like 1
• NCBI Official Synonym Full Names: GABA(A) receptor-associated protein like 1
• NCBI Official Symbol: GABARAPL1
• NCBI Official Synonym Symbols: ATG8; GEC1; APG8L; ATG8B; ATG8L; APG8-LIKE
• NCBI Protein Information: gamma-aminobutyric acid receptor-associated protein-like 1; GEC-1; GABARAPL1-a; early estrogen-regulated protein; glandular epithelial cell protein 1; GABA(A) receptor-associated protein-like 1
• UniProt Protein Name: Gamma-aminobutyric acid receptor-associated protein-like 1
• Protein Family: Gamma-aminobutyric acid receptor-associated protein
• UniProt Gene Name: GABARAPL1
• UniProt Synonym Gene Names: GEC1; GEC-1
• UniProt Entry Name: GBRL1_HUMAN

Uniprot Description

GABARAPL1: is a ubiquitin-like protein that is a constituent of the ATG8-conjugation system, one of two evolutionarily conserved phosphatidylethanolamine conjugation systems necessary for the formation of the autophagosome. The human ATG8 system includes seven ubiquitin-like light chain proteins (LCPs) that are homologs of yeast LC3: MAP1LC3A, -B, -C, GABARAP, GABARAPL1, -2, and -3. Pro-LCPs are cleaved by ATG4B to expose a C-terminal glycine residue, the cytosolic LCP-I form. The exposed C-terminus is conjugated to the head group amine of phosphatidylethanolamine (PE) through an amide bond by a sequence of ubiquitination-like reactions that involves an E1 (ATG7), an E2 (ATG3), and an E3 (a complex including ATG5, ATG12, and ATG16L). The PE-congugated form (LCP-II) is tightly associated with the autophagosomal membrane. The LCP-II forms can also be delipidated by the ATG4 proteases: most of the LCPs are delipidated and liberated from the membrane before autophagosomes fuse with lysosomes. Increases cell-surface expression of kappa-type opioid receptor through facilitating anterograde intracellular trafficking of the receptor. Belongs to the MAP1 LC3 family. Interacts with GABRG2 and beta-tubulin. Interacts with KOR-1.

Protein type: Microtubule-binding; Autophagy; Vesicle; Adaptor/scaffold; Ubiquitin-like modifier

Chromosomal Location of Human Ortholog: 12p13.2

Cellular Component: dendrite cytoplasm; Golgi apparatus; microtubule; cytoplasmic vesicle membrane; extrinsic to membrane; mitochondrion; endoplasmic reticulum; autophagic vacuole; intracellular; cytosol

Molecular Function: protein binding; Tat protein binding; microtubule binding; beta-tubulin binding; GABA receptor binding

Biological Process: mitochondrion degradation; autophagic vacuole formation