FOLH1B blocking peptide
FOLH1B Peptide - middle region
Gene Names
FOLH1B; PSM; GCP3; FOLH2; FOLHP; PSMAL; GCPIII; PSMA-LIKE
Reactivity
Human
Applications
Western Blot
Synonyms
FOLH1B; FOLH1B Peptide - middle region; FOLH1B blocking peptide
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: ELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLG
Sequence Length
442
Applicable Applications for FOLH1B blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for FOLH1B blocking peptide
This is a synthetic peptide designed for use in combination with anti-FOLH1B Antibody, made
Target Description: FOLH1B has both folate hydrolase and N-acetylated-alpha-linked-acidic dipeptidase (NAALADase) activity.
Target Description: FOLH1B has both folate hydrolase and N-acetylated-alpha-linked-acidic dipeptidase (NAALADase) activity.
Product Categories/Family for FOLH1B blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50kDa
NCBI Official Full Name
putative N-acetylated-alpha-linked acidic dipeptidase
NCBI Official Synonym Full Names
folate hydrolase 1B
NCBI Official Symbol
FOLH1B
NCBI Official Synonym Symbols
PSM; GCP3; FOLH2; FOLHP; PSMAL; GCPIII; PSMA-LIKE
NCBI Protein Information
putative N-acetylated-alpha-linked acidic dipeptidase
UniProt Protein Name
Putative N-acetylated-alpha-linked acidic dipeptidase
Protein Family
UniProt Gene Name
FOLH1B
UniProt Synonym Gene Names
PSMAL; NAALADase
UniProt Entry Name
FOH1B_HUMAN
Uniprot Description
Function: Has both folate hydrolase and N-acetylated-alpha-linked-acidic dipeptidase (NAALADase) activity
By similarity.Exhibits a dipeptidyl-peptidase IV type activity
By similarity.
Cofactor: Binds 2 zinc ions per subunit
By similarity. Required for NAALADase activity
By similarity.
Subcellular location: Cytoplasm
Probable Ref.1.
Tissue specificity: Kidney and liver. Not expressed in the prostate. Ref.1
Sequence similarities: Belongs to the peptidase M28 family. M28B subfamily.
Research Articles on FOLH1B
Similar Products
Product Notes
The FOLH1B folh1b (Catalog #AAA3243383) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The FOLH1B Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FOLH1B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FOLH1B folh1b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ELKSPDEGFE GKSLYESWTK KSPSPEFSGM PRISKLGSGN DFEVFFQRLG. It is sometimes possible for the material contained within the vial of "FOLH1B, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
