<
Immunohistochemistry (IHC)
(Rabbit Anti-BHLHE40 AntibodyParaffin Embedded Tissue: Human alveolar cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Rabbit BHLHB2 Polyclonal Antibody | anti-BHLHE40 antibody
BHLHB2 antibody - middle region
Gene Names
BHLHE40; DEC1; HLHB2; BHLHB2; Clast5; SHARP2; STRA13; Stra14; SHARP-2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
BHLHB2; Polyclonal Antibody; BHLHB2 antibody - middle region; anti-BHLHE40 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SEKGDLRSEQPCFKSDHGRRFTMGERIGAIKQESEEPPTKKNRMQLSDDE
Sequence Length
412
Applicable Applications for anti-BHLHE40 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 92%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%; Sheep: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human BHLHB2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(Rabbit Anti-BHLHE40 AntibodyParaffin Embedded Tissue: Human alveolar cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Immunohistochemistry (IHC)
(Rabbit Anti-BHLHE40 AntibodyParaffin Embedded Tissue: Human alveolar cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Western Blot (WB)
(Host: RabbitTarget Name: BHLHB2Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: BHLHB2Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: BHLHB2Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: BHLHB2Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(WB Suggested Anti-BHLHB2 Antibody Titration: 0.2-1 ug/mlPositive Control: Transfected 293T)
Western Blot (WB)
(WB Suggested Anti-BHLHB2 Antibody Titration: 0.2-1 ug/mlPositive Control: Transfected 293T)
Related Product Information for anti-BHLHE40 antibody
This is a rabbit polyclonal antibody against BHLHB2. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: BHLHB2 is a basic helix-loop-helix protein expressed in various tissues. Expression in the chondrocytes is responsive to the addition of Bt2cAMP. Differentiated embryo chondrocyte expressed gene 1 is believed to be involved in the control of cell differentiation.DEC1 encodes a basic helix-loop-helix protein expressed in various tissues. Expression in the chondrocytes is responsive to the addition of Bt2cAMP. Differentiated embryo chondrocyte expressed gene 1 is believed to be involved in the control of cell differentiation.DEC1 encodes a basic helix-loop-helix protein expressed in various tissues. Expression in the chondrocytes is responsive to the addition of Bt2cAMP. Differentiated embryo chondrocyte expressed gene 1 is believed to be involved in the control of cell differentiation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Target Description: BHLHB2 is a basic helix-loop-helix protein expressed in various tissues. Expression in the chondrocytes is responsive to the addition of Bt2cAMP. Differentiated embryo chondrocyte expressed gene 1 is believed to be involved in the control of cell differentiation.DEC1 encodes a basic helix-loop-helix protein expressed in various tissues. Expression in the chondrocytes is responsive to the addition of Bt2cAMP. Differentiated embryo chondrocyte expressed gene 1 is believed to be involved in the control of cell differentiation.DEC1 encodes a basic helix-loop-helix protein expressed in various tissues. Expression in the chondrocytes is responsive to the addition of Bt2cAMP. Differentiated embryo chondrocyte expressed gene 1 is believed to be involved in the control of cell differentiation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-BHLHE40 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
class E basic helix-loop-helix protein 40
NCBI Official Synonym Full Names
basic helix-loop-helix family member e40
NCBI Official Symbol
BHLHE40
NCBI Official Synonym Symbols
DEC1; HLHB2; BHLHB2; Clast5; SHARP2; STRA13; Stra14; SHARP-2
NCBI Protein Information
class E basic helix-loop-helix protein 40
UniProt Protein Name
Class E basic helix-loop-helix protein 40
Protein Family
UniProt Gene Name
BHLHE40
UniProt Synonym Gene Names
BHLHB2; DEC1; SHARP2; STRA13; bHLHe40; bHLHb2; DEC1; SHARP-2
UniProt Entry Name
BHE40_HUMAN
NCBI Description
This gene encodes a basic helix-loop-helix protein expressed in various tissues. The encoded protein can interact with ARNTL or compete for E-box binding sites in the promoter of PER1 and repress CLOCK/ARNTL's transactivation of PER1. This gene is believed to be involved in the control of circadian rhythm and cell differentiation. [provided by RefSeq, Feb 2014]
Research Articles on BHLHE40
Similar Products
Product Notes
The BHLHE40 bhlhe40 (Catalog #AAA3201821) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BHLHB2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's BHLHB2 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the BHLHE40 bhlhe40 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SEKGDLRSEQ PCFKSDHGRR FTMGERIGAI KQESEEPPTK KNRMQLSDDE. It is sometimes possible for the material contained within the vial of "BHLHB2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
