Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

FNTB blocking peptide

FNTB Peptide - middle region

Gene Names
CHURC1-FNTB; FNTB; FTase-beta
Reactivity
Human
Applications
Western Blot
Synonyms
FNTB; FNTB Peptide - middle region; FNTB blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: VCQFLELCQSPEGGFGGGPGQYPHLAPTYAAVNALCIIGTEEAYDIINRE
Sequence Length
391
Applicable Applications for FNTB blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for FNTB blocking peptide
This is a synthetic peptide designed for use in combination with FNTB Antibody, made
Product Categories/Family for FNTB blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43 kDa
NCBI Official Full Name
CHURC1-FNTB protein isoform 2
NCBI Official Synonym Full Names
CHURC1-FNTB readthrough
NCBI Official Symbol
CHURC1-FNTB
NCBI Official Synonym Symbols
FNTB; FTase-beta
NCBI Protein Information
CHURC1-FNTB protein
UniProt Protein Name
Protein farnesyltransferase subunit beta
UniProt Gene Name
FNTB
UniProt Synonym Gene Names
FTase-beta
UniProt Entry Name
FNTB_HUMAN

NCBI Description

This locus represents naturally occurring read-through transcription between the neighboring CHURC1 (churchill domain containing 1) and FNTB (farnesyltransferase, CAAX box, beta) on chromosome 14. The read-through transcript produces a fusion protein that shares sequence identity with each individual gene product. [provided by RefSeq, Feb 2011]

Uniprot Description

FNTB: a subunit of farnesyltransferase that is responsible for peptide-binding. Farnesyltransferase catalyzes the transfer of a farnesyl moiety from farnesyl pyrophosphate to a cysteine at the fourth position from the C-terminus of several proteins.

Protein type: Transferase; EC 2.5.1.58

Chromosomal Location of Human Ortholog: 14q23.3

Cellular Component: microtubule associated complex; cytosol

Molecular Function: protein binding; farnesyltranstransferase activity; isoprenoid binding; zinc ion binding; drug binding; peptide binding; protein farnesyltransferase activity

Biological Process: rhodopsin mediated signaling; phototransduction, visible light; negative regulation of cell proliferation; positive regulation of fibroblast proliferation; protein farnesylation; response to inorganic substance; regulation of rhodopsin mediated signaling; wound healing; response to cytokine stimulus; positive regulation of cell cycle; response to organic cyclic substance; positive regulation of nitric-oxide synthase biosynthetic process

Similar Products

Product Notes

The FNTB fntb (Catalog #AAA3245089) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The FNTB Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FNTB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FNTB fntb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VCQFLELCQS PEGGFGGGPG QYPHLAPTYA AVNALCIIGT EEAYDIINRE. It is sometimes possible for the material contained within the vial of "FNTB, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.