Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

FGR blocking peptide

FGR Peptide - middle region

Gene Names
FGR; SRC2; c-fgr; c-src2; p55-Fgr; p58-Fgr; p55c-fgr; p58c-fgr
Reactivity
Human
Synonyms
FGR; FGR Peptide - middle region; FGR blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: GERLACKIADFGLARLIKDDEYNPCQGSKFPIKWTAPEAALFGRFTIKSD
Sequence Length
529
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for FGR blocking peptide
This is a synthetic peptide designed for use in combination with anti- FGR Antibody, made

Target Description: This gene is a member of the Src family of protein tyrosine kinases (PTKs). The encoded protein contains N-terminal sites for myristylation and palmitylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactions with phosphotyrosine-containing and proline-rich motifs, respectively. The protein localizes to plasma membrane ruffles, and functions as a negative regulator of cell migration and adhesion triggered by the beta-2 integrin signal transduction pathway. Infection with Epstein-Barr virus results in the overexpression of this gene. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Product Categories/Family for FGR blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58 kDa
NCBI Official Full Name
tyrosine-protein kinase Fgr
NCBI Official Synonym Full Names
FGR proto-oncogene, Src family tyrosine kinase
NCBI Official Symbol
FGR
NCBI Official Synonym Symbols
SRC2; c-fgr; c-src2; p55-Fgr; p58-Fgr; p55c-fgr; p58c-fgr
NCBI Protein Information
tyrosine-protein kinase Fgr
UniProt Protein Name
Tyrosine-protein kinase Fgr
Protein Family
UniProt Gene Name
FGR
UniProt Synonym Gene Names
SRC2
UniProt Entry Name
FGR_HUMAN

NCBI Description

This gene is a member of the Src family of protein tyrosine kinases (PTKs). The encoded protein contains N-terminal sites for myristylation and palmitylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactions with phosphotyrosine-containing and proline-rich motifs, respectively. The protein localizes to plasma membrane ruffles, and functions as a negative regulator of cell migration and adhesion triggered by the beta-2 integrin signal transduction pathway. Infection with Epstein-Barr virus results in the overexpression of this gene. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

FGR: a non-receptor tyrosine kinase of the Src family. Contains one SH2 and one SH3 domain. Beta 2 integrin signaling induces its c-Cbl-mediated ubiquitination in adherent neutrophils. An ortholog of v-fgr feline oncogene. Mildly amplified in hormone-resistant prostate cancer. Copy number either increased or decreased in other cancers.

Protein type: Protein kinase, TK; Kinase, protein; EC 2.7.10.2; Mitochondrial; Oncoprotein; Protein kinase, tyrosine (non-receptor); TK group; Src family

Chromosomal Location of Human Ortholog: 1p36.2-p36.1

Cellular Component: extrinsic to internal side of plasma membrane; cytoskeleton; mitochondrial inner membrane; plasma membrane; mitochondrial intermembrane space; cytosol; actin cytoskeleton

Molecular Function: protein binding; phosphotyrosine binding; protein-tyrosine kinase activity; non-membrane spanning protein tyrosine kinase activity; protein kinase binding; ATP binding

Biological Process: integrin-mediated signaling pathway; cell migration; peptidyl-tyrosine phosphorylation; response to virus; protein amino acid autophosphorylation; positive regulation of phosphoinositide 3-kinase activity; immune response-regulating cell surface receptor signaling pathway; positive regulation of mast cell degranulation; regulation of phagocytosis; protein amino acid phosphorylation; regulation of innate immune response; regulation of cell proliferation; positive regulation of phosphoinositide 3-kinase cascade; regulation of cell shape; defense response to Gram-positive bacterium; innate immune response; regulation of protein kinase activity; blood coagulation; cell differentiation; transmembrane receptor protein tyrosine kinase signaling pathway; positive regulation of cell migration; positive regulation of cytokine secretion

Research Articles on FGR

Similar Products

Product Notes

The FGR fgr (Catalog #AAA3248563) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The FGR Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: GERLACKIAD FGLARLIKDD EYNPCQGSKF PIKWTAPEAA LFGRFTIKSD. It is sometimes possible for the material contained within the vial of "FGR, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.