Rabbit FGR Polyclonal Antibody | anti-FGR antibody

FGR antibody - middle region

Cat. Num. AAA3211716

• Gene Names: FGR; SRC2; c-fgr; c-src2; p55-Fgr; p58-Fgr; p55c-fgr; p58c-fgr
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
• Applications: Western Blot
• Purity: Affinity Purified
• Synonyms: FGR; Polyclonal Antibody; FGR antibody - middle region; anti-FGR antibody

• Host: Rabbit
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: CPPGCPASLYEAMEQTWRLDPEERPTFEYLQSFLEDYFTSAEPQYQPGDQ
• Sequence Length: 529

• Applicable Applications for anti-FGR antibody: Western Blot (WB)
• Homology: Cow: 86%; Dog: 93%; Guinea Pig: 83%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 92%; Rat: 93%; Zebrafish: 83%
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FGR
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: MouseTarget Name: FGRSample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

Related Product Information for anti-FGR antibody

This is a rabbit polyclonal antibody against FGR. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene is a member of the Src family of protein tyrosine kinases (PTKs). The encoded protein contains N-terminal sites for myristylation and palmitylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactions with phosphotyrosine-containing and proline-rich motifs, respectively. The protein localizes to plasma membrane ruffles, and functions as a negative regulator of cell migration and adhesion triggered by the beta-2 integrin signal transduction pathway. Infection with Epstein-Barr virus results in the overexpression of this gene. Multiple alternatively spliced variants, encoding the same protein, have been identified.

Product Categories/Family for anti-FGR antibody

Polyclonal; Signal Transduction; Various; Microbiology; Phosphorylation

NCBI and Uniprot Product Information

• NCBI GI #: 112382241
• NCBI GeneID: 2268
• NCBI Accession #: NP_001036194
• NCBI GenBank Nucleotide #: NM_001042729
• UniProt Accession #: P09769
• Molecular Weight: 59kDa
• NCBI Official Full Name: tyrosine-protein kinase Fgr
• NCBI Official Synonym Full Names: FGR proto-oncogene, Src family tyrosine kinase
• NCBI Official Symbol: FGR
• NCBI Official Synonym Symbols: SRC2; c-fgr; c-src2; p55-Fgr; p58-Fgr; p55c-fgr; p58c-fgr
• NCBI Protein Information: tyrosine-protein kinase Fgr
• UniProt Protein Name: Tyrosine-protein kinase Fgr
• Protein Family: Tyrosine-protein kinase
• UniProt Gene Name: FGR
• UniProt Synonym Gene Names: SRC2
• UniProt Entry Name: FGR_HUMAN

NCBI Description

This gene is a member of the Src family of protein tyrosine kinases (PTKs). The encoded protein contains N-terminal sites for myristylation and palmitylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactions with phosphotyrosine-containing and proline-rich motifs, respectively. The protein localizes to plasma membrane ruffles, and functions as a negative regulator of cell migration and adhesion triggered by the beta-2 integrin signal transduction pathway. Infection with Epstein-Barr virus results in the overexpression of this gene. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

FGR: a non-receptor tyrosine kinase of the Src family. Contains one SH2 and one SH3 domain. Beta 2 integrin signaling induces its c-Cbl-mediated ubiquitination in adherent neutrophils. An ortholog of v-fgr feline oncogene. Mildly amplified in hormone-resistant prostate cancer. Copy number either increased or decreased in other cancers.

Protein type: Protein kinase, TK; Kinase, protein; EC 2.7.10.2; Mitochondrial; Oncoprotein; Protein kinase, tyrosine (non-receptor); TK group; Src family

Chromosomal Location of Human Ortholog: 1p36.2-p36.1

Cellular Component: extrinsic to internal side of plasma membrane; cytoskeleton; mitochondrial inner membrane; plasma membrane; mitochondrial intermembrane space; cytosol; actin cytoskeleton

Molecular Function: protein binding; phosphotyrosine binding; protein-tyrosine kinase activity; non-membrane spanning protein tyrosine kinase activity; protein kinase binding; ATP binding

Biological Process: integrin-mediated signaling pathway; cell migration; peptidyl-tyrosine phosphorylation; response to virus; protein amino acid autophosphorylation; positive regulation of phosphoinositide 3-kinase activity; immune response-regulating cell surface receptor signaling pathway; positive regulation of mast cell degranulation; regulation of phagocytosis; protein amino acid phosphorylation; regulation of innate immune response; regulation of cell proliferation; positive regulation of phosphoinositide 3-kinase cascade; regulation of cell shape; defense response to Gram-positive bacterium; innate immune response; regulation of protein kinase activity; blood coagulation; cell differentiation; transmembrane receptor protein tyrosine kinase signaling pathway; positive regulation of cell migration; positive regulation of cytokine secretion