Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

FCGR1A blocking peptide

FCGR1A Peptide - middle region

Gene Names
FCGR1A; CD64; FCRI; CD64A; IGFR1
Reactivity
Human
Synonyms
FCGR1A; FCGR1A Peptide - middle region; FCGR1A blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: NVLKRSPELELQVLGLQLPTPVWFHVLFYLAVGIMFLVNTVLWVTIRKEL
Sequence Length
374
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for FCGR1A blocking peptide
This is a synthetic peptide designed for use in combination with anti- FCGR1A Antibody, made

Target Description: This gene encodes a protein that plays an important role in the immune response. This protein is a high-affinity Fc-gamma receptor. The gene is one of three related gene family members located on chromosome 1.
Product Categories/Family for FCGR1A blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41 kDa
NCBI Official Full Name
high affinity immunoglobulin gamma Fc receptor I
NCBI Official Synonym Full Names
Fc fragment of IgG receptor Ia
NCBI Official Symbol
FCGR1A
NCBI Official Synonym Symbols
CD64; FCRI; CD64A; IGFR1
NCBI Protein Information
high affinity immunoglobulin gamma Fc receptor I
UniProt Protein Name
High affinity immunoglobulin gamma Fc receptor I
UniProt Gene Name
FCGR1A
UniProt Synonym Gene Names
FCG1; FCGR1; IGFR1; IgG Fc receptor I; FcRI; FcgammaRIa
UniProt Entry Name
FCGR1_HUMAN

NCBI Description

This gene encodes a protein that plays an important role in the immune response. This protein is a high-affinity Fc-gamma receptor. The gene is one of three related gene family members located on chromosome 1. [provided by RefSeq, Jul 2008]

Uniprot Description

FCGR1A: High affinity receptor for the Fc region of immunoglobulins gamma. Functions in both innate and adaptive immune responses. Belongs to the immunoglobulin superfamily. FCGR1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, misc.; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1q21.2-q21.3

Cellular Component: early endosome membrane; plasma membrane; integral to membrane

Molecular Function: protein binding; IgG binding; receptor signaling protein activity

Biological Process: antigen processing and presentation of peptide antigen via MHC class I; cytokine and chemokine mediated signaling pathway; antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent; innate immune response; antigen processing and presentation of exogenous peptide antigen via MHC class I; immune response; signal transduction; phagocytosis, engulfment

Research Articles on FCGR1A

Similar Products

Product Notes

The FCGR1A fcgr1a (Catalog #AAA3246391) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The FCGR1A Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: NVLKRSPELE LQVLGLQLPT PVWFHVLFYL AVGIMFLVNT VLWVTIRKEL. It is sometimes possible for the material contained within the vial of "FCGR1A, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.