Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (RFC4 rabbit polyclonal antibody. Western Blot analysis of RFC4 expression in human kidney.)

Rabbit anti-Human RFC4 Polyclonal Antibody | anti-RFC4 antibody

RFC4 (Replication Factor C Subunit 4, Activator 1 Subunit 4, Replication Factor C 37kD Subunit, RF-C 37kD Subunit, RFC37, Activator 1 37kD Subunit, A1 37kD Subunit, MGC27291) (PE)

Gene Names
RFC4; A1; RFC37
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RFC4; Polyclonal Antibody; RFC4 (Replication Factor C Subunit 4; Activator 1 Subunit 4; Replication Factor C 37kD Subunit; RF-C 37kD Subunit; RFC37; Activator 1 37kD Subunit; A1 37kD Subunit; MGC27291) (PE); anti-RFC4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human RFC4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-RFC4 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human RFC4, aa1-363 (NP_002907.1).
Immunogen Sequence
MQAFLKGTSISTKPPLTKDRGVAASAGSSGENKKAKPVPWVEKYRPKCVDEVAFQEEVVAVLKKSLEGADLPNLLFYGPPGTGKTSTILAAARELFGPELFRLRVLELNASDERGIQVVREKVKNFAQLTVSGSRSDGKPCPPFKIVILDEADSMTSAAQAALRRTMEKESKTTRFCLICNYVSRIIEPLTSRCSKFRFKPLSDKIQQQRLLDIAKKENVKISDEGIAYLVKVSEGDLRKAITFLQSATRLTGGKEITEKVITDIAGVIPAEKIDGVFAACQSGSFDKLEAVVKDLIDEGHAATQLVNQLHDVVVENNLSDKQKSIITEKLAEVDKCLADGADEHLQLISLCATVMQQLSQNC
Conjugate
PE
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(RFC4 rabbit polyclonal antibody. Western Blot analysis of RFC4 expression in human kidney.)

Western Blot (WB) (RFC4 rabbit polyclonal antibody. Western Blot analysis of RFC4 expression in human kidney.)

Western Blot (WB)

(RFC4 rabbit polyclonal antibody. Western Blot analysis of RFC4 expression in HeLa.)

Western Blot (WB) (RFC4 rabbit polyclonal antibody. Western Blot analysis of RFC4 expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of RFC4 expression in transfected 293T cell line by RFC4 polyclonal antibody. Lane 1: RFC4 transfected lysate (39.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of RFC4 expression in transfected 293T cell line by RFC4 polyclonal antibody. Lane 1: RFC4 transfected lysate (39.7kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-RFC4 antibody
The elongation of primed DNA templates by DNA polymerase delta and DNA polymerase epsilon requires the accessory proteins proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also named activator 1, is a protein complex consisting of five distinct subunits of 140, 40, 38, 37, and 36kD. RFC4 is the 37kD subunit. This subunit forms a core complex with the 36 and 40kD subunits. The core complex possesses DNA-dependent ATPase activity, which was found to be stimulated by PCNA in an in vitro system.
Product Categories/Family for anti-RFC4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
33,675 Da
NCBI Official Full Name
replication factor C subunit 4
NCBI Official Synonym Full Names
replication factor C (activator 1) 4, 37kDa
NCBI Official Symbol
RFC4
NCBI Official Synonym Symbols
A1; RFC37
NCBI Protein Information
replication factor C subunit 4; A1 37 kDa subunit; RF-C 37 kDa subunit; RFC 37 kDa subunit; activator 1 37 kDa subunit; activator 1 subunit 4; replication factor C 37 kDa subunit
Protein Family

Similar Products

Product Notes

The RFC4 (Catalog #AAA6392385) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RFC4 (Replication Factor C Subunit 4, Activator 1 Subunit 4, Replication Factor C 37kD Subunit, RF-C 37kD Subunit, RFC37, Activator 1 37kD Subunit, A1 37kD Subunit, MGC27291) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RFC4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RFC4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RFC4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.