Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

EIF4E blocking peptide

EIF4E Peptide - middle region

Gene Names
EIF4E; CBP; EIF4F; AUTS19; EIF4E1; eIF-4E; EIF4EL1
Reactivity
Human
Synonyms
EIF4E; EIF4E Peptide - middle region; EIF4E blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: FKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLDRFWLETLLCLIGESFD
Sequence Length
217
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for EIF4E blocking peptide
This is a synthetic peptide designed for use in combination with anti- EIF4E Antibody, made

Target Description: The protein encoded by this gene is a component of the eukaryotic translation initiation factor 4F complex, which recognizes the 7-methylguanosine cap structure at the 5' end of messenger RNAs. The encoded protein aids in translation initiation by recruiting ribosomes to the 5'-cap structure. Association of this protein with the 4F complex is the rate-limiting step in translation initiation. This gene acts as a proto-oncogene, and its expression and activation is associated with transformation and tumorigenesis. Several pseudogenes of this gene are found on other chromosomes. Alternative splicing results in multiple transcript variants. 
Product Categories/Family for EIF4E blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25 kDa
NCBI Official Full Name
eukaryotic translation initiation factor 4E isoform 3
NCBI Official Synonym Full Names
eukaryotic translation initiation factor 4E
NCBI Official Symbol
EIF4E
NCBI Official Synonym Symbols
CBP; EIF4F; AUTS19; EIF4E1; eIF-4E; EIF4EL1
NCBI Protein Information
eukaryotic translation initiation factor 4E
UniProt Protein Name
Eukaryotic translation initiation factor 4E
UniProt Gene Name
EIF4E
UniProt Synonym Gene Names
EIF4EL1; EIF4F; eIF-4E; eIF4E
UniProt Entry Name
IF4E_HUMAN

NCBI Description

The protein encoded by this gene is a component of the eukaryotic translation initiation factor 4F complex, which recognizes the 7-methylguanosine cap structure at the 5' end of messenger RNAs. The encoded protein aids in translation initiation by recruiting ribosomes to the 5'-cap structure. Association of this protein with the 4F complex is the rate-limiting step in translation initiation. This gene acts as a proto-oncogene, and its expression and activation is associated with transformation and tumorigenesis. Several pseudogenes of this gene are found on other chromosomes. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2015]

Uniprot Description

EIF4E: a protein of the eukaryotic initiation factor 4E family. Recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation of protein synthesis and facilitates ribosome binding by inducing the unwinding of the mRNAs secondary structures. Phosphorylation increases the ability of the protein to bind to mRNA caps and to form the EIF4F complex.

Protein type: Translation initiation; Translation

Chromosomal Location of Human Ortholog: 4q23

Cellular Component: mRNA cap complex; stress granule; cytoplasm; eukaryotic translation initiation factor 4F complex; cytosol

Molecular Function: protein binding; eukaryotic initiation factor 4G binding; translation initiation factor activity; RNA cap binding

Biological Process: translation; viral reproduction; cytokine and chemokine mediated signaling pathway; positive regulation of mitotic cell cycle; regulation of translation; poly(A) tail shortening; mRNA export from nucleus; cellular protein metabolic process; insulin receptor signaling pathway; translational initiation; gene expression; mRNA catabolic process, deadenylation-dependent decay; lung development; G1/S transition of mitotic cell cycle

Disease: Autism, Susceptibility To, 19

Research Articles on EIF4E

Similar Products

Product Notes

The EIF4E eif4e (Catalog #AAA3247813) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The EIF4E Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: FKDGIEPMWE DEKNKRGGRW LITLNKQQRR SDLDRFWLET LLCLIGESFD. It is sometimes possible for the material contained within the vial of "EIF4E, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.