Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: EIF4ESample Tissue: Human MCF7 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human EIF4E Polyclonal Antibody | anti-EIF4E antibody

EIF4E Antibody - middle region

Gene Names
EIF4E; CBP; EIF4F; AUTS19; EIF4E1; eIF-4E; EIF4EL1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
EIF4E; Polyclonal Antibody; EIF4E Antibody - middle region; anti-EIF4E antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLDRFWLETLLCLIGESFD
Sequence Length
217
Applicable Applications for anti-EIF4E antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human EIF4E
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: EIF4ESample Tissue: Human MCF7 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: EIF4ESample Tissue: Human MCF7 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-EIF4E antibody
The protein encoded by this gene is a component of the eukaryotic translation initiation factor 4F complex, which recognizes the 7-methylguanosine cap structure at the 5' end of messenger RNAs. The encoded protein aids in translation initiation by recruiting ribosomes to the 5'-cap structure. Association of this protein with the 4F complex is the rate-limiting step in translation initiation. This gene acts as a proto-oncogene, and its expression and activation is associated with transformation and tumorigenesis. Several pseudogenes of this gene are found on other chromosomes. Alternative splicing results in multiple transcript variants. 
Product Categories/Family for anti-EIF4E antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25 kDa
NCBI Official Full Name
eukaryotic translation initiation factor 4E isoform 3
NCBI Official Synonym Full Names
eukaryotic translation initiation factor 4E
NCBI Official Symbol
EIF4E
NCBI Official Synonym Symbols
CBP; EIF4F; AUTS19; EIF4E1; eIF-4E; EIF4EL1
NCBI Protein Information
eukaryotic translation initiation factor 4E
UniProt Protein Name
Eukaryotic translation initiation factor 4E
UniProt Gene Name
EIF4E
UniProt Synonym Gene Names
EIF4EL1; EIF4F; eIF-4E; eIF4E
UniProt Entry Name
IF4E_HUMAN

NCBI Description

The protein encoded by this gene is a component of the eukaryotic translation initiation factor 4F complex, which recognizes the 7-methylguanosine cap structure at the 5' end of messenger RNAs. The encoded protein aids in translation initiation by recruiting ribosomes to the 5'-cap structure. Association of this protein with the 4F complex is the rate-limiting step in translation initiation. This gene acts as a proto-oncogene, and its expression and activation is associated with transformation and tumorigenesis. Several pseudogenes of this gene are found on other chromosomes. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2015]

Uniprot Description

EIF4E: a protein of the eukaryotic initiation factor 4E family. Recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation of protein synthesis and facilitates ribosome binding by inducing the unwinding of the mRNAs secondary structures. Phosphorylation increases the ability of the protein to bind to mRNA caps and to form the EIF4F complex.

Protein type: Translation initiation; Translation

Chromosomal Location of Human Ortholog: 4q23

Cellular Component: mRNA cap complex; stress granule; cytoplasm; eukaryotic translation initiation factor 4F complex; cytosol

Molecular Function: protein binding; eukaryotic initiation factor 4G binding; translation initiation factor activity; RNA cap binding

Biological Process: translation; viral reproduction; cytokine and chemokine mediated signaling pathway; positive regulation of mitotic cell cycle; regulation of translation; poly(A) tail shortening; mRNA export from nucleus; cellular protein metabolic process; insulin receptor signaling pathway; translational initiation; gene expression; mRNA catabolic process, deadenylation-dependent decay; lung development; G1/S transition of mitotic cell cycle

Disease: Autism, Susceptibility To, 19

Research Articles on EIF4E

Similar Products

Product Notes

The EIF4E eif4e (Catalog #AAA3223167) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EIF4E Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's EIF4E can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the EIF4E eif4e for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FKDGIEPMWE DEKNKRGGRW LITLNKQQRR SDLDRFWLET LLCLIGESFD. It is sometimes possible for the material contained within the vial of "EIF4E, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.