Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

EIF2B1 blocking peptide

EIF2B1 Peptide - middle region

Gene Names
EIF2B1; EIF2B; EIF2BA
Reactivity
Human
Synonyms
EIF2B1; EIF2B1 Peptide - middle region; EIF2B1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: LFPLNQQDVPDKFKYKADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTD
Sequence Length
305
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for EIF2B1 blocking peptide
This is a synthetic peptide designed for use in combination with anti- EIF2B1 Antibody, made

Target Description: This gene encodes one of five subunits of eukaryotic translation initiation factor 2B (EIF2B), a GTP exchange factor for eukaryotic initiation factor 2 and an essential regulator for protein synthesis. Mutations in this gene and the genes encoding other EIF2B subunits have been associated with leukoencephalopathy with vanishing white matter.
Product Categories/Family for EIF2B1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33 kDa
NCBI Official Full Name
translation initiation factor eIF-2B subunit alpha
NCBI Official Synonym Full Names
eukaryotic translation initiation factor 2B subunit alpha
NCBI Official Symbol
EIF2B1
NCBI Official Synonym Symbols
EIF2B; EIF2BA
NCBI Protein Information
translation initiation factor eIF-2B subunit alpha
UniProt Protein Name
Translation initiation factor eIF-2B subunit alpha
UniProt Gene Name
EIF2B1
UniProt Synonym Gene Names
EIF2BA
UniProt Entry Name
EI2BA_HUMAN

NCBI Description

This gene encodes one of five subunits of eukaryotic translation initiation factor 2B (EIF2B), a GTP exchange factor for eukaryotic initiation factor 2 and an essential regulator for protein synthesis. Mutations in this gene and the genes encoding other EIF2B subunits have been associated with leukoencephalopathy with vanishing white matter. [provided by RefSeq, Oct 2009]

Uniprot Description

eIF2B-alpha: Catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP. Defects in EIF2B1 are a cause of leukodystrophy with vanishing white matter (VWM). VWM is a leukodystrophy that occurs mainly in children. Neurological signs include progressive cerebellar ataxia, spasticity, inconstant optic atrophy and relatively preserved mental abilities. The disease is chronic-progressive with, in most individuals, additional episodes of rapid deterioration following febrile infections or minor head trauma. While childhood onset is the most common form of the disorder, some severe forms are apparent at birth. A severe, early-onset form seen among the Cree and Chippewayan populations of Quebec and Manitoba is called Cree leukoencephalopathy. Milder forms may not become evident until adolescence or adulthood. Some females with milder forms of the disease who survive to adolescence exhibit ovarian dysfunction. This variant of the disorder is called ovarioleukodystrophy. Belongs to the eIF-2B alpha/beta/delta subunits family.

Protein type: Translation initiation; Translation

Chromosomal Location of Human Ortholog: 12q24.31

Cellular Component: eukaryotic translation initiation factor 2B complex; membrane; cytoplasm; plasma membrane; cytosol

Molecular Function: protein binding; GDP binding; GTP binding; translation initiation factor activity; guanyl-nucleotide exchange factor activity; S-methyl-5-thioribose-1-phosphate isomerase activity; enzyme regulator activity

Biological Process: response to peptide hormone stimulus; translation; cellular response to stimulus; cellular protein metabolic process; methionine salvage; response to heat; translational initiation; response to glucose stimulus; negative regulation of translation initiation in response to stress; gene expression; oligodendrocyte development; regulation of translational initiation; positive regulation of GTPase activity

Disease: Leukoencephalopathy With Vanishing White Matter

Research Articles on EIF2B1

Similar Products

Product Notes

The EIF2B1 eif2b1 (Catalog #AAA3246306) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The EIF2B1 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: LFPLNQQDVP DKFKYKADTL KVAQTGQDLK EEHPWVDYTA PSLITLLFTD. It is sometimes possible for the material contained within the vial of "EIF2B1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.