Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

DYRK1B blocking peptide

DYRK1B Peptide - middle region

Gene Names
DYRK1B; MIRK; AOMS3
Reactivity
Human
Synonyms
DYRK1B; DYRK1B Peptide - middle region; DYRK1B blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: SGSSSDNRTYRYSNRYCGGPGPPITDCEMNSPQVPPSQPLRPWAGGDVPH
Sequence Length
589
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for DYRK1B blocking peptide
This is a synthetic peptide designed for use in combination with anti- DYRK1B Antibody, made

Target Description: This gene encodes a member of a family of nuclear-localized protein kinases. The encoded protein participates in the regulation of the cell cycle. Expression of this gene may be altered in tumor cells, and mutations in this gene were found to cause abdominal obesity-metabolic syndrome 3. Alternative splicing results in multiple transcript variants.
Product Categories/Family for DYRK1B blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64 kDa
NCBI Official Full Name
dual specificity tyrosine-phosphorylation-regulated kinase 1B isoform p69
NCBI Official Synonym Full Names
dual specificity tyrosine phosphorylation regulated kinase 1B
NCBI Official Symbol
DYRK1B
NCBI Official Synonym Symbols
MIRK; AOMS3
NCBI Protein Information
dual specificity tyrosine-phosphorylation-regulated kinase 1B
UniProt Protein Name
Dual specificity tyrosine-phosphorylation-regulated kinase 1B
UniProt Gene Name
DYRK1B
UniProt Synonym Gene Names
MIRK
UniProt Entry Name
DYR1B_HUMAN

NCBI Description

This gene encodes a member of a family of nuclear-localized protein kinases. The encoded protein participates in the regulation of the cell cycle. Expression of this gene may be altered in tumor cells, and mutations in this gene were found to cause abdominal obesity-metabolic syndrome 3. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2014]

Uniprot Description

DYRK1B: a dual-specificity protein kinase of the DYRK family. Localizes in the nucleus, where it enhances the transcriptional activity of TCF1/HNF1A. A co-activator of FKHR (FOXO1a)-dependent glucose-6-phosphatase gene expression. Induced by members of the Rho-family in myoblasts. Highest expression in skeletal muscle, testis, heart and brain with little expression in colon or lung. Expressed in a variety of tumor cell lines. Contains a bipartite nuclear targeting signal sequence. Three splice-variant isoforms have been described.

Protein type: Kinase, protein; EC 2.7.12.1; Protein kinase, CMGC; Protein kinase, dual-specificity (non-receptor); CMGC group; DYRK family; Dyrk1 subfamily

Chromosomal Location of Human Ortholog: 19q13.2

Cellular Component: nucleus

Molecular Function: protein serine/threonine kinase activity; protein binding; protein-tyrosine kinase activity; transcription coactivator activity; protein serine/threonine/tyrosine kinase activity; ATP binding; protein kinase activity

Biological Process: peptidyl-tyrosine phosphorylation; positive regulation of transcription, DNA-dependent; protein amino acid phosphorylation; myoblast fusion

Disease: Abdominal Obesity-metabolic Syndrome 3

Research Articles on DYRK1B

Similar Products

Product Notes

The DYRK1B dyrk1b (Catalog #AAA3248041) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The DYRK1B Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: SGSSSDNRTY RYSNRYCGGP GPPITDCEMN SPQVPPSQPL RPWAGGDVPH. It is sometimes possible for the material contained within the vial of "DYRK1B, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.