Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

DSE blocking peptide

DSE Peptide-middle region

Reactivity
Human
Synonyms
DSE; DSE Peptide-middle region; DSEP; DSEPI; SART2; EDSMC2; SART-2; DS-epi1; DSE blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
NRSFLSFKSGKLGGRAIYDIVHRNKYKDWIKGWRNFNAGHEHPDQNSFTF
Quality Control
The peptide is characterized by mass spectroscopy
Protein Size
958 amino acids
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for DSE blocking peptide
This is a synthetic peptide designed for use in combination with anti-DSE Antibody. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Description of Target: The protein encoded by this gene is a tumor-rejection antigen. It is localized to the endoplasmic reticulum and functions to convert D-glucuronic acid to L-iduronic acid during the biosynthesis of dermatan sulfate. This antigen possesses tumor epitopes capable of inducing HLA-A24-restricted and tumor-specific cytotoxic T lymphocytes in cancer patients and may be useful for specific immunotherapy. Mutations in this gene cause inmusculocontractural Ehlers-Danlos syndrome. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 9, and a paralogous gene exists on chromosome 18.

NCBI and Uniprot Product Information

NCBI GeneID
UniProt Accession #
Molecular Weight
105kDa
UniProt Protein Name
Dermatan-sulfate epimerase
UniProt Gene Name
DSE
UniProt Synonym Gene Names
SART2; DS epimerase; SART-2
UniProt Entry Name
DSE_HUMAN

Uniprot Description

SART2: Converts D-glucuronic acid to L-iduronic acid (IdoUA) residues. Belongs to the dermatan-sulfate isomerase family.

Protein type: Isomerase; Endoplasmic reticulum; Membrane protein, integral; EC 5.1.3.19; Glycan Metabolism - chondroitin sulfate biosynthesis; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 6q22

Cellular Component: Golgi membrane; Golgi apparatus; endoplasmic reticulum; integral to membrane

Molecular Function: chondroitin-glucuronate 5-epimerase activity

Biological Process: chondroitin sulfate metabolic process; chondroitin sulfate biosynthetic process; glycosaminoglycan metabolic process; heparan sulfate proteoglycan biosynthetic process; carbohydrate metabolic process; pathogenesis; dermatan sulfate biosynthetic process

Disease: Ehlers-danlos Syndrome, Musculocontractural Type 2

Similar Products

Product Notes

The DSE dse (Catalog #AAA3249353) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The DSE Peptide-middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: NRSFLSFKSG KLGGRAIYDI VHRNKYKDWI KGWRNFNAGH EHPDQNSFTF. It is sometimes possible for the material contained within the vial of "DSE, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.