Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

DNAJC10 blocking peptide

DNAJC10 Peptide - N-terminal region

Gene Names
DNAJC10; JPDI; MTHr; ERdj5; PDIA19
Reactivity
Human
Applications
Western Blot
Synonyms
DNAJC10; DNAJC10 Peptide - N-terminal region; DNAJC10 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: DLRKKYDKYGEKGLEDNQGGQYESWNYYRYDFGIYDDDPEIITLERREFD
Sequence Length
747
Applicable Applications for DNAJC10 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for DNAJC10 blocking peptide
This is a synthetic peptide designed for use in combination with anti-DNAJC10 Antibody, made

Target Description: This gene encodes an endoplasmic reticulum co-chaperone which is part of the endoplasmic reticulum-associated degradation complex involved in recognizing and degrading misfolded proteins. The encoded protein reduces incorrect disulfide bonds in misfolded glycoproteins. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Product Categories/Family for DNAJC10 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
82kDa
NCBI Official Full Name
dnaJ homolog subfamily C member 10 isoform 2
NCBI Official Synonym Full Names
DnaJ heat shock protein family (Hsp40) member C10
NCBI Official Symbol
DNAJC10
NCBI Official Synonym Symbols
JPDI; MTHr; ERdj5; PDIA19
NCBI Protein Information
dnaJ homolog subfamily C member 10
UniProt Protein Name
DnaJ homolog subfamily C member 10
Protein Family
UniProt Gene Name
DNAJC10
UniProt Synonym Gene Names
ERDJ5; ER-resident protein ERdj5; ERdj5; MTHr
UniProt Entry Name
DJC10_HUMAN

NCBI Description

This gene encodes an endoplasmic reticulum co-chaperone which is part of the endoplasmic reticulum-associated degradation complex involved in recognizing and degrading misfolded proteins. The encoded protein reduces incorrect disulfide bonds in misfolded glycoproteins. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Oct 2012]

Uniprot Description

DNAJC10: This endoplasmic reticulum co-chaperone may play a role in protein folding and translocation across the endoplasmic reticulum membrane. May act as a co-chaperone for HSPA5. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Chaperone; Secreted, signal peptide; Secreted; Endoplasmic reticulum

Chromosomal Location of Human Ortholog: 2q32.1

Cellular Component: membrane; endoplasmic reticulum; endoplasmic reticulum lumen

Molecular Function: disulfide oxidoreductase activity; protein binding; ATPase activator activity; chaperone binding; protein disulfide oxidoreductase activity; Hsp70 protein binding; misfolded protein binding; oxidoreductase activity, acting on sulfur group of donors, disulfide as acceptor; ATPase binding

Biological Process: ER-associated protein catabolic process; negative regulation of protein amino acid phosphorylation; positive regulation of ATPase activity; cell redox homeostasis

Research Articles on DNAJC10

Similar Products

Product Notes

The DNAJC10 dnajc10 (Catalog #AAA3234400) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The DNAJC10 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DNAJC10 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DNAJC10 dnajc10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DLRKKYDKYG EKGLEDNQGG QYESWNYYRY DFGIYDDDPE IITLERREFD. It is sometimes possible for the material contained within the vial of "DNAJC10, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.