DMAC2L blocking peptide

DMAC2L Peptide - N-terminal region

Cat. Num. AAA3242772

• Gene Names: DMAC2L; FB; ATPW; ATP5S; HSU79253
• Reactivity: Human
• Applications: Western Blot
• Synonyms: DMAC2L; DMAC2L Peptide - N-terminal region; DMAC2L blocking peptide

• Reactivity: Human
• Form/Format: Lyophilized powder
• Sequence: LRCGAMVRYHGQERWQKDYNHLPTGPLDKYKIQAIDATDSCIMSIGFDHM
• Sequence Length: 215

• Applicable Applications for DMAC2L blocking peptide: Western Blot (WB)
• Preparation and Storage: Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Related Product Information for DMAC2L blocking peptide

This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. This gene encodes the subunit s, also known as factor B, of the proton channel. This subunit is necessary for the energy transduction activity of the ATP synthase complexes. Alternatively spliced transcript variants encoding different isoforms have been identified.

Product Categories/Family for DMAC2L blocking peptide

Peptide

NCBI and Uniprot Product Information

• NCBI GI #: 51558774
• NCBI GeneID: 27109
• NCBI Accession #: NP_001003803
• NCBI GenBank Nucleotide #: NM_001003803
• UniProt Accession #: Q99766
• Molecular Weight: 24kDa
• NCBI Official Full Name: ATP synthase subunit s, mitochondrial isoform a
• NCBI Official Synonym Full Names: distal membrane arm assembly complex 2 like
• NCBI Official Symbol: DMAC2L
• NCBI Official Synonym Symbols: FB; ATPW; ATP5S; HSU79253
• NCBI Protein Information: ATP synthase subunit s, mitochondrial
• UniProt Protein Name: ATP synthase subunit s, mitochondrial
• UniProt Gene Name: ATP5S
• UniProt Synonym Gene Names: ATPW; FB
• UniProt Entry Name: ATP5S_HUMAN

NCBI Description

This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. This gene encodes the subunit s, also known as factor B, of the proton channel. This subunit is necessary for the energy transduction activity of the ATP synthase complexes. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

ATP5S: Involved in regulation of mitochondrial membrane ATP synthase. Necessary for H(+) conduction of ATP synthase. Facilitates energy-driven catalysis of ATP synthesis by blocking a proton leak through an alternative proton exit pathway. Belongs to the ATP synthase subunit s family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Mitochondrial

Chromosomal Location of Human Ortholog: 14q21.3

Cellular Component: proton-transporting ATP synthase complex, coupling factor F(o); mitochondrial inner membrane

Molecular Function: metal ion binding; hydrogen ion transmembrane transporter activity

Biological Process: cellular metabolic process; proton transport; mitochondrial ATP synthesis coupled proton transport