Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

CTF1 blocking peptide

CTF1 Peptide - N-terminal region

Gene Names
CTF1; CT1; CT-1
Reactivity
Human
Applications
Western Blot
Synonyms
CTF1; CTF1 Peptide - N-terminal region; CTF1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
HSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAG
Sequence Length
201
Applicable Applications for CTF1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for CTF1 blocking peptide
This is a synthetic peptide designed for use in combination with anti-CTF1 Antibody, made

Target Description: CTF1 induces cardiac myocyte hypertrophy in vitro. It binds to and activates the ILST/gp130 receptor. It belongs to the IL-6 superfamily.
Product Categories/Family for CTF1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21kDa
NCBI Official Full Name
cardiotrophin-1 isoform 1
NCBI Official Synonym Full Names
cardiotrophin 1
NCBI Official Symbol
CTF1
NCBI Official Synonym Symbols
CT1; CT-1
NCBI Protein Information
cardiotrophin-1
UniProt Protein Name
Cardiotrophin-1
Protein Family
UniProt Gene Name
CTF1
UniProt Synonym Gene Names
CT-1
UniProt Entry Name
CTF1_HUMAN

NCBI Description

The protein encoded by this gene is a secreted cytokine that induces cardiac myocyte hypertrophy in vitro. It has been shown to bind and activate the ILST/gp130 receoptor. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2008]

Uniprot Description

CTF1: Induces cardiac myocyte hypertrophy in vitro. Binds to and activates the ILST/gp130 receptor. Belongs to the IL-6 superfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cytokine

Chromosomal Location of Human Ortholog: 16p11.2

Cellular Component: extracellular space; extracellular region

Molecular Function: leukemia inhibitory factor receptor binding; cytokine activity

Biological Process: nervous system development; cell proliferation; muscle development; cell-cell signaling; leukemia inhibitory factor signaling pathway; positive regulation of cell proliferation; neuron development

Research Articles on CTF1

Similar Products

Product Notes

The CTF1 ctf1 (Catalog #AAA3235478) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The CTF1 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CTF1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CTF1 ctf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: HSLAHLLTKY AEQLLQEYVQ LQGDPFGLPS FSPPRLPVAG LSAPAPSHAG. It is sometimes possible for the material contained within the vial of "CTF1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.