Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

CRNKL1 blocking peptide

CRNKL1 Peptide - C-terminal region

Gene Names
CRNKL1; CLF; CRN; Clf1; HCRN; SYF3; MSTP021
Reactivity
Human
Applications
Western Blot
Synonyms
CRNKL1; CRNKL1 Peptide - C-terminal region; CRNKL1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
SFEEEFGTASDKERVDKLMPEKVKKRRKVQTDDGSDAGWEEYFDYIFPED
Sequence Length
848
Applicable Applications for CRNKL1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for CRNKL1 blocking peptide
This is a synthetic peptide designed for use in combination with anti-CRNKL1 Antibody, made

Target Description: The crooked neck (crn) gene of Drosophila is essential for embryogenesis and is thought to be involved in cell cycle progression and pre-mRNA splicing. This gene is similar in sequence to crn and encodes a protein which can localize to pre-mRNA splicing complexes in the nucleus. The encoded protein, which contains many tetratricopeptide repeats, is required for pre-mRNA splicing.
Product Categories/Family for CRNKL1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
93kDa
NCBI Official Full Name
crooked neck-like protein 1 isoform a
NCBI Official Synonym Full Names
crooked neck pre-mRNA splicing factor 1
NCBI Official Symbol
CRNKL1
NCBI Official Synonym Symbols
CLF; CRN; Clf1; HCRN; SYF3; MSTP021
NCBI Protein Information
crooked neck-like protein 1
UniProt Protein Name
Crooked neck-like protein 1
Protein Family
UniProt Gene Name
CRNKL1
UniProt Synonym Gene Names
CRN
UniProt Entry Name
CRNL1_HUMAN

NCBI Description

The crooked neck (crn) gene of Drosophila is essential for embryogenesis and is thought to be involved in cell cycle progression and pre-mRNA splicing. A protein encoded by this human locus has been found to localize to pre-mRNA splicing complexes in the nucleus and is necessary for pre-mRNA splicing. Alternatively spliced transcript variants have been described. [provided by RefSeq, Jul 2013]

Uniprot Description

CRNKL1: Involved in pre-mRNA splicing process. Belongs to the crooked-neck family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Spliceosome; RNA splicing; RNA processing

Chromosomal Location of Human Ortholog: 20p11.2

Cellular Component: spliceosome; cytoplasm; nuclear speck

Molecular Function: protein binding; RNA binding

Biological Process: nuclear mRNA splicing, via spliceosome; spliceosome assembly

Research Articles on CRNKL1

Similar Products

Product Notes

The CRNKL1 crnkl1 (Catalog #AAA3242387) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The CRNKL1 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CRNKL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CRNKL1 crnkl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SFEEEFGTAS DKERVDKLMP EKVKKRRKVQ TDDGSDAGWE EYFDYIFPED. It is sometimes possible for the material contained within the vial of "CRNKL1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.