Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

CREB3L2 blocking peptide

CREB3L2 Peptide - C-terminal region

Gene Names
CREB3L2; BBF2H7
Reactivity
Human
Synonyms
CREB3L2; CREB3L2 Peptide - C-terminal region; CREB3L2 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: GGWDRGSSLLRVSGLESRPDVDLPHFIISNETSLEKSVLLELQQHLVSAK
Sequence Length
520
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for CREB3L2 blocking peptide
This is a synthetic peptide designed for use in combination with anti- CREB3L2 Antibody, made

Target Description: This gene encodes a member of the oasis bZIP transcription factor family. Members of this family can dimerize but form homodimers only. The encoded protein is a transcriptional activator. Translocations between this gene on chromosome 7 and the gene fused in sarcoma on chromosome 16 can be found in some tumors. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for CREB3L2 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57 kDa
NCBI Official Full Name
cyclic AMP-responsive element-binding protein 3-like protein 2 isoform 1
NCBI Official Synonym Full Names
cAMP responsive element binding protein 3 like 2
NCBI Official Symbol
CREB3L2
NCBI Official Synonym Symbols
BBF2H7
NCBI Protein Information
cyclic AMP-responsive element-binding protein 3-like protein 2
UniProt Protein Name
Cyclic AMP-responsive element-binding protein 3-like protein 2
UniProt Gene Name
CREB3L2
UniProt Synonym Gene Names
BBF2H7; cAMP-responsive element-binding protein 3-like protein 2
UniProt Entry Name
CR3L2_HUMAN

NCBI Description

This gene encodes a member of the oasis bZIP transcription factor family. Members of this family can dimerize but form homodimers only. The encoded protein is a transcriptional activator. Translocations between this gene on chromosome 7 and the gene fused in sarcoma on chromosome 16 can be found in some tumors. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2011]

Uniprot Description

CREB3L2: Transcriptional activator which is processed and activated during endoplasmic reticulum stress late phase. Binds to the cAMP response element (CRE) and activates transcription through CRE. Regulates the transcription of unfolded protein response target genes, preventing accumulation of unfolded proteins in damaged neurons. Also regulates the expression of SEC23A, accelerating protein trafficking from the ER to the Golgi thereby playing a key role in chondrocyte differentiation and formation of epiphyseal cartilage. A chromosomal aberration involving CREB3L2 is found in low grade fibromyxoid sarcoma (LGFMS). Translocation t(7;16)(q33;p11) with FUS. Belongs to the bZIP family. ATF subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor; Membrane protein, integral; Oncoprotein

Chromosomal Location of Human Ortholog: 7q34

Cellular Component: endoplasmic reticulum membrane; endoplasmic reticulum; integral to membrane; nucleus

Biological Process: ER to Golgi vesicle-mediated transport; transcription, DNA-dependent; unfolded protein response; cartilage development; positive regulation of transcription, DNA-dependent; chondrocyte differentiation; positive regulation of transcription from RNA polymerase II promoter

Research Articles on CREB3L2

Similar Products

Product Notes

The CREB3L2 creb3l2 (Catalog #AAA3227195) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The CREB3L2 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: GGWDRGSSLL RVSGLESRPD VDLPHFIISN ETSLEKSVLL ELQQHLVSAK. It is sometimes possible for the material contained within the vial of "CREB3L2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.