Western Blot (WB)
(Western blot analysis of extracts of mouse stomach, using GKN1 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Rabbit anti-Mouse GKN1 Polyclonal Antibody | anti-GKN1 antibody
GKN1 Polyclonal Antibody
Gene Names
GKN1; FOV; CA11; AMP18; BRICD1; foveolin
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity Purification
Synonyms
GKN1; Polyclonal Antibody; GKN1 Polyclonal Antibody; AMP18; BRICD1; CA11; FOV; foveolin; anti-GKN1 antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
LGVFLAPALANYNINVNDDNNNAGSGQQSVSVNNEHNVANVDNNNGWDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQSLDALVKEKKLQGKGPGGPPPKGLMYSVNPNKVDDLSKFGKNIANMCRGIPTYMAEEMQEASLFFYSGTCYTTSVL
Sequence Length
199
Applicable Applications for anti-GKN1 antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
Recombinant protein of human GKN1
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Secreted
Positive Samples
Mouse stomach
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of mouse stomach, using GKN1 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Western Blot (WB)
(Western blot analysis of extracts of mouse stomach, using GKN1 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Related Product Information for anti-GKN1 antibody
The protein encoded by this gene is found to be down-regulated in human gastric cancer tissue as compared to normal gastric mucosa.
Product Categories/Family for anti-GKN1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated: 21kDa
Observed: 22kDa
Observed: 22kDa
NCBI Official Full Name
gastrokine-1
NCBI Official Synonym Full Names
gastrokine 1
NCBI Official Symbol
GKN1
NCBI Official Synonym Symbols
FOV; CA11; AMP18; BRICD1; foveolin
NCBI Protein Information
gastrokine-1
UniProt Protein Name
Gastrokine-1
Protein Family
UniProt Gene Name
GKN1
UniProt Synonym Gene Names
AMP18; CA11; AMP-18
NCBI Description
The protein encoded by this gene is found to be down-regulated in human gastric cancer tissue as compared to normal gastric mucosa. [provided by RefSeq, Jul 2008]
Uniprot Description
Has mitogenic activity and may be involved in maintaining the integrity of the gastric mucosal epithelium.
Research Articles on GKN1
Similar Products
Product Notes
The GKN1 gkn1 (Catalog #AAA9133155) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GKN1 Polyclonal Antibody reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's GKN1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the GKN1 gkn1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LGVFLAPALA NYNINVNDDN NNAGSGQQSV SVNNEHNVAN VDNNNGWDSW NSIWDYGNGF AATRLFQKKT CIVHKMNKEV MPSIQSLDAL VKEKKLQGKG PGGPPPKGLM YSVNPNKVDD LSKFGKNIAN MCRGIPTYMA EEMQEASLFF YSGTCYTTSV L. It is sometimes possible for the material contained within the vial of "GKN1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
