Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

CMPK2 blocking peptide

CMPK2 Peptide - C-terminal region

Gene Names
CMPK2; NDK; TYKi; TMPK2; UMP-CMPK2
Reactivity
Human
Applications
Western Blot
Synonyms
CMPK2; CMPK2 Peptide - C-terminal region; CMPK2 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: PSCIGQWRKIFDDEPTIIRRAFYSLGNYIVASEIAKESAKSPVIVDRYWH
Sequence Length
449
Applicable Applications for CMPK2 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for CMPK2 blocking peptide
This is a synthetic peptide designed for use in combination with anti-CMPK2 Antibody, made

Target Description: This gene encodes one of the enzymes in the nucleotide synthesis salvage pathway that may participate in terminal differentiation of monocytic cells. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for CMPK2 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49kDa
NCBI Official Full Name
UMP-CMP kinase 2, mitochondrial isoform 1
NCBI Official Synonym Full Names
cytidine/uridine monophosphate kinase 2
NCBI Official Symbol
CMPK2
NCBI Official Synonym Symbols
NDK; TYKi; TMPK2; UMP-CMPK2
NCBI Protein Information
UMP-CMP kinase 2, mitochondrial
UniProt Protein Name
UMP-CMP kinase 2, mitochondrial
UniProt Gene Name
CMPK2
UniProt Entry Name
CMPK2_HUMAN

NCBI Description

This gene encodes one of the enzymes in the nucleotide synthesis salvage pathway that may participate in terminal differentiation of monocytic cells. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2012]

Uniprot Description

CMPK2: May participate in dUTP and dCTP synthesis in mitochondria. Is able to phosphorylate dUMP, dCMP, CMP, UMP and monophosphates of the pyrimidine nucleoside analogs ddC, dFdC, araC, BVDU and FdUrd with ATP as phosphate donor. Efficacy is highest for dUMP followed by dCMP; CMP and UMP are poor substrates. May be involved in mtDNA depletion caused by long term treatment with ddC or other pyrimidine analogs. Belongs to the thymidylate kinase family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 2.7.4.6; Nucleotide Metabolism - pyrimidine; EC 2.7.4.14; Kinase, other

Chromosomal Location of Human Ortholog: 2p25.2

Cellular Component: nucleoplasm; mitochondrion; cytosol

Molecular Function: UMP kinase activity; nucleoside diphosphate kinase activity; thymidylate kinase activity; cytidylate kinase activity; ATP binding

Biological Process: dUDP biosynthetic process; nucleoside triphosphate biosynthetic process; dTDP biosynthetic process; dTTP biosynthetic process; nucleoside diphosphate phosphorylation

Research Articles on CMPK2

Similar Products

Product Notes

The CMPK2 cmpk2 (Catalog #AAA3236299) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The CMPK2 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CMPK2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CMPK2 cmpk2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PSCIGQWRKI FDDEPTIIRR AFYSLGNYIV ASEIAKESAK SPVIVDRYWH. It is sometimes possible for the material contained within the vial of "CMPK2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.