Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.77kD).)

Mouse anti-Human 2019-03-09 Monoclonal Antibody | anti-MARCH9 antibody

MARCH9 (E3 Ubiquitin-protein Ligase MARCH9, Membrane-associated RING Finger Protein 9, Membrane-associated RING-CH Protein IX, MARCH-IX, RING Finger Protein 179, RNF179, FLJ36578, MARCH-IX) (AP)

Gene Names
MARCH9; RNF179; MARCH-IX
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
2019-03-09; Monoclonal Antibody; MARCH9 (E3 Ubiquitin-protein Ligase MARCH9; Membrane-associated RING Finger Protein 9; Membrane-associated RING-CH Protein IX; MARCH-IX; RING Finger Protein 179; RNF179; FLJ36578; MARCH-IX) (AP); anti-MARCH9 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Clone Number
2B5
Specificity
Recognizes human MARCH9.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-MARCH9 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa240-346 from human MARCH9 (NP_612405) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
HEGSSVYRIFKRWQAVNQQWKVLNYDKTKDIGGDAGGGTAGKSGPRNSRTGPTSGATSRPPAAQRMRTLLPQRCGYTILHLLGQLRPPDARSSSHSGREVVMRVTT
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.77kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.77kD).)

Testing Data

(Detection limit for recombinant GST tagged MARCH9 is 3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged MARCH9 is 3ng/ml as a capture antibody.)
Related Product Information for anti-MARCH9 antibody
MARCH9 belongs to the membrane associated RING-CH (MARCH) family of genes which encode a novel group of RING-type ubiquitin E3 ligases. It is the first ubiquitin E3 ligase to control expression of the critical cell adhesion molecule ICAM-1. The expression of the protein causes ubiquitination and downregulation of ICAM-1. A short alternative transcript of MARCH9 lacking the RING-CH domain, termed MARCH9 RINGless, is shown to act as a positive regulator of MARCH9 activity. Overexpression of the protein, leads to downregulation of cell surface major histocompatibility complex (MHC) class I and CD4. Human MARCH9 gene maps to chromosome 12q14.1.
Product Categories/Family for anti-MARCH9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37,772 Da
NCBI Official Full Name
E3 ubiquitin-protein ligase MARCH9
NCBI Official Synonym Full Names
membrane-associated ring finger (C3HC4) 9
NCBI Official Symbol
MARCH9
NCBI Official Synonym Symbols
RNF179; MARCH-IX
NCBI Protein Information
E3 ubiquitin-protein ligase MARCH9; RING finger protein 179; membrane-associated RING-CH protein IX; membrane-associated RING finger protein 9
UniProt Protein Name
E3 ubiquitin-protein ligase MARCH9
UniProt Gene Name
MARCH9
UniProt Synonym Gene Names
RNF179; MARCH-IX
UniProt Entry Name
MARH9_HUMAN

Similar Products

Product Notes

The MARCH9 march9 (Catalog #AAA6132228) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MARCH9 (E3 Ubiquitin-protein Ligase MARCH9, Membrane-associated RING Finger Protein 9, Membrane-associated RING-CH Protein IX, MARCH-IX, RING Finger Protein 179, RNF179, FLJ36578, MARCH-IX) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's 2019-03-09 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MARCH9 march9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "2019-03-09, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.