Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

CLCN4 blocking peptide

CLCN4 Peptide - N-terminal region

Gene Names
CLCN4; CLC4; ClC-4; MRX15; MRX49; ClC-4A; MRXSRC
Reactivity
Human
Applications
Western Blot
Synonyms
CLCN4; CLCN4 Peptide - N-terminal region; CLCN4 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: LMDFLDEPFPDVGTYEDFHTIDWLREKSRDTDRHRKITSKSKESIWEFIK
Sequence Length
760
Applicable Applications for CLCN4 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for CLCN4 blocking peptide
This is a synthetic peptide designed for use in combination with anti-CLCN4 Antibody, made

Target Description: The CLCN family of voltage-dependent chloride channel genes comprises nine members (CLCN1-7, Ka and Kb) which demonstrate quite diverse functional characteristics while sharing significant sequence homology. Chloride channel 4 has an evolutionary conserved CpG island and is conserved in both mouse and hamster. This gene is mapped in close proximity to APXL (Apical protein Xenopus laevis-like) and OA1 (Ocular albinism type I), which are both located on the human X chromosome at band p22.3. The physiological role of chloride channel 4 remains unknown but may contribute to the pathogenesis of neuronal disorders. Alternate splicing results in two transcript variants that encode different proteins.
Product Categories/Family for CLCN4 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
83kDa
NCBI Official Full Name
H(+)/Cl(-) exchange transporter 4 isoform 1
NCBI Official Synonym Full Names
chloride voltage-gated channel 4
NCBI Official Symbol
CLCN4
NCBI Official Synonym Symbols
CLC4; ClC-4; MRX15; MRX49; ClC-4A; MRXSRC
NCBI Protein Information
H(+)/Cl(-) exchange transporter 4
UniProt Protein Name
H(+)/Cl(-) exchange transporter 4
UniProt Gene Name
CLCN4
UniProt Synonym Gene Names
ClC-4
UniProt Entry Name
CLCN4_HUMAN

NCBI Description

The CLCN family of voltage-dependent chloride channel genes comprises nine members (CLCN1-7, Ka and Kb) which demonstrate quite diverse functional characteristics while sharing significant sequence homology. Chloride channel 4 has an evolutionary conserved CpG island and is conserved in both mouse and hamster. This gene is mapped in close proximity to APXL (Apical protein Xenopus laevis-like) and OA1 (Ocular albinism type I), which are both located on the human X chromosome at band p22.3. The physiological role of chloride channel 4 remains unknown but may contribute to the pathogenesis of neuronal disorders. Alternate splicing results in two transcript variants that encode different proteins. [provided by RefSeq, Mar 2012]

Uniprot Description

CLCN4: Proton-coupled chloride transporter. Functions as antiport system and exchanges chloride ions against protons. Belongs to the chloride channel (TC 2.A.49) family. ClC-4/CLCN4 subfamily.

Protein type: Transporter; Membrane protein, multi-pass; Transporter, ion channel; Membrane protein, integral

Chromosomal Location of Human Ortholog: Xp22.3

Cellular Component: late endosome membrane; early endosome membrane; integral to membrane; endosome membrane

Molecular Function: chloride channel activity; voltage-gated chloride channel activity; ATP binding; antiporter activity

Biological Process: transport; chloride transport; transmembrane transport

Research Articles on CLCN4

Similar Products

Product Notes

The CLCN4 clcn4 (Catalog #AAA3244305) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The CLCN4 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CLCN4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CLCN4 clcn4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LMDFLDEPFP DVGTYEDFHT IDWLREKSRD TDRHRKITSK SKESIWEFIK. It is sometimes possible for the material contained within the vial of "CLCN4, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.