Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

CDKL5 blocking peptide

CDKL5 Peptide - C-terminal region

Gene Names
CDKL5; ISSX; STK9; EIEE2; CFAP247
Reactivity
Human
Applications
Western Blot
Synonyms
CDKL5; CDKL5 Peptide - C-terminal region; CDKL5 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
SQASGGSSNIRQEPAPKGRPALQLPDGGCDGRRQRHHSGPQDRRFMLRTT
Sequence Length
1030
Applicable Applications for CDKL5 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for CDKL5 blocking peptide
This is a synthetic peptide designed for use in combination with anti-CDKL5 Antibody, made

Target Description: CDKL5 is a member of Ser/Thr protein kinase family. This protein is a phosphorylated protein with protein kinase activity. Mutations in this CDKL5 gene have been associated with X-linked infantile spasm syndrome (ISSX), also known as X-linked West syndrome, and Rett syndrome (RTT).
Product Categories/Family for CDKL5 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
115kDa
NCBI Official Full Name
cyclin-dependent kinase-like 5 isoform 1
NCBI Official Synonym Full Names
cyclin dependent kinase like 5
NCBI Official Symbol
CDKL5
NCBI Official Synonym Symbols
ISSX; STK9; EIEE2; CFAP247
NCBI Protein Information
cyclin-dependent kinase-like 5
UniProt Protein Name
Cyclin-dependent kinase-like 5
Protein Family
UniProt Gene Name
CDKL5
UniProt Synonym Gene Names
STK9
UniProt Entry Name
CDKL5_HUMAN

NCBI Description

This gene is a member of Ser/Thr protein kinase family and encodes a phosphorylated protein with protein kinase activity. Mutations in this gene have been associated with X-linked infantile spasm syndrome (ISSX), also known as X-linked West syndrome, and Rett syndrome (RTT). Alternate transcriptional splice variants have been characterized. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: Mediates phosphorylation of MECP2. Ref.7 Ref.8

Catalytic activity: ATP + a protein = ADP + a phosphoprotein.

Subunit structure: Interacts with MECP2. Ref.7

Subcellular location: Nucleus Ref.8.

Tissue specificity: Expressed in brain, lung, kidney, prostate, ovary, placenta, pancreas and testis.

Post-translational modification: Autophosphorylated. Ref.7 Ref.8

Involvement in disease: Chromosomal aberrations involving CDKL5 are found in patients manifesting early-onset seizures and spams and psychomotor impairment. Translocation t(X;6)(p22.3;q14); translocation t(X;7)(p22.3;p15).Epileptic encephalopathy, early infantile, 2 (EIEE2) [MIM:300672]: A severe form of epilepsy characterized by seizures or spasms beginning in infancy. Patients with epileptic encephalopathy early infantile type 2 manifest features resembling Rett syndrome such as microcephaly, lack of speech development, stereotypic hand movements. However, EIEE2 and Rett syndrome are considered two distinct entities.Note: The disease is caused by mutations affecting the gene represented in this entry. Ref.2 Ref.6 Ref.7 Ref.8 Ref.13 Ref.14 Ref.15 Ref.16 Ref.19 Ref.20 Ref.21 Ref.22 Ref.23

Sequence similarities: Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.Contains 1 protein kinase domain.

Caution: It is uncertain whether Met-1 or Met-10 is the initiator.

Sequence caution: The sequence CAA61445.1 differs from that shown. Reason: Frameshift at position 415.

Research Articles on CDKL5

Similar Products

Product Notes

The CDKL5 cdkl5 (Catalog #AAA3239515) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The CDKL5 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CDKL5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CDKL5 cdkl5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SQASGGSSNI RQEPAPKGRP ALQLPDGGCD GRRQRHHSGP QDRRFMLRTT. It is sometimes possible for the material contained within the vial of "CDKL5, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.