Mouse anti-Human CDKL5 Monoclonal Antibody | anti-CDKL5 antibody

CDKL5 (STK9, Cyclin-dependent Kinase-like 5, Serine/Threonine-protein Kinase 9) (FITC)

Cat. Num. AAA6146431

• Gene Names: CDKL5; ISSX; STK9; EIEE2; CFAP247
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CDKL5; Monoclonal Antibody; CDKL5 (STK9; Cyclin-dependent Kinase-like 5; Serine/Threonine-protein Kinase 9) (FITC); anti-CDKL5 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1D9
• Specificity: Recognizes human CDKL5.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
• Sequence Length: 3441

• Applicable Applications for anti-CDKL5 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa722-831 from human CDKL5 (AAH36091) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: RPDNSFHENNVSTRVSSLPSESSSGTNHSKRQPAFDPWKSPENISHSEQLKEKEKQGFFRSMKKKKKKSQTVPNSDSPDLLTLQKSIHSASTPSSRPKEWRPEKISDLQT
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged CDKL5 is ~0.1ng/ml as a capture antibody.)

Related Product Information for anti-CDKL5 antibody

Defects in STK9, a dual-specificity serine/threonine kinase, are a cause of atypical Rett syndrome. Rett syndrome is an X-linked dominant disease. It is a progressive neurologic developmental disorder and one of the most common causes of mental retardation in females. Patients appear to develop normally until 6 to 18 months of age, then gradually lose speech and purposeful hand movements and develop microcephaly, seizures, autism, ataxia, intermittent hyperventilation, and stereotypic hand movements. After initial regression, the condition stabilizes and patients usually survive into adulthood. Rett syndrome due to CDKL5-associated mutations is characterized by a severe early-onset phenotype and atypical features such as infantile spasms.

Product Categories/Family for anti-CDKL5 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 23271296
• NCBI GeneID: 6792
• NCBI Official Full Name: Homo sapiens cyclin-dependent kinase-like 5, mRNA
• NCBI Official Synonym Full Names: cyclin dependent kinase like 5
• NCBI Official Symbol: CDKL5
• NCBI Official Synonym Symbols: ISSX; STK9; EIEE2; CFAP247
• NCBI Protein Information: cyclin-dependent kinase-like 5
• Protein Family: Cyclin-dependent kinase

NCBI Description

This gene is a member of Ser/Thr protein kinase family and encodes a phosphorylated protein with protein kinase activity. Mutations in this gene have been associated with X-linked infantile spasm syndrome (ISSX), also known as X-linked West syndrome, and Rett syndrome (RTT). Alternate transcriptional splice variants have been characterized. [provided by RefSeq, Jul 2008]