Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

CDK2AP1 blocking peptide

CDK2AP1 Peptide - C-terminal region

Gene Names
CDK2AP1; DOC1; ST19; DORC1; doc-1; p12DOC-1
Reactivity
Human
Applications
Western Blot
Synonyms
CDK2AP1; CDK2AP1 Peptide - C-terminal region; CDK2AP1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
LLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS
Sequence Length
115
Applicable Applications for CDK2AP1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for CDK2AP1 blocking peptide
This is a synthetic peptide designed for use in combination with anti-CDK2AP1 Antibody, made

Target Description: The protein encoded by this gene is a specific CDK2-associated protein, which is thought to negatively regulate CDK2 activity by sequestering monomeric CDK2, and targeting CDK2 for proteolysis. This protein was found to also interact with DNA polymerase alpha/primase and mediate the phosphorylation of the large p180 subunit, which suggested the regulatory role in DNA replication during S phase of the cell cycle. A similar gene in hamster was isolated from, and functions as a growth suppressor of normal keratinocytes.
Product Categories/Family for CDK2AP1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12kDa
NCBI Official Full Name
cyclin-dependent kinase 2-associated protein 1 isoform 1
NCBI Official Synonym Full Names
cyclin dependent kinase 2 associated protein 1
NCBI Official Symbol
CDK2AP1
NCBI Official Synonym Symbols
DOC1; ST19; DORC1; doc-1; p12DOC-1
NCBI Protein Information
cyclin-dependent kinase 2-associated protein 1
UniProt Protein Name
Cyclin-dependent kinase 2-associated protein 1
UniProt Gene Name
CDK2AP1
UniProt Synonym Gene Names
CDKAP1; DOC1; CDK2-associated protein 1; DOC-1
UniProt Entry Name
CDKA1_HUMAN

NCBI Description

The protein encoded by this gene is a cyclin-dependent kinase 2 (CDK2) -associated protein which is thought to negatively regulate CDK2 activity by sequestering monomeric CDK2, and targeting CDK2 for proteolysis. This protein was found to also interact with DNA polymerase alpha/primase and mediate the phosphorylation of the large p180 subunit, which suggests a regulatory role in DNA replication during the S-phase of the cell cycle. This protein also forms a core subunit of the nucleosome remodeling and histone deacetylation (NURD) complex that epigenetically regulates embryonic stem cell differentiation. This gene thus plays a role in both cell-cycle and epigenetic regulation. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2012]

Uniprot Description

CDK2AP1: specific inhibitor of the cell-cycle kinase CDK2. Belongs to the CDK2AP family.

Protein type: Tumor suppressor; DNA replication; Cell cycle regulation

Chromosomal Location of Human Ortholog: 12q24.31

Cellular Component: perinuclear region of cytoplasm; nucleus

Biological Process: positive regulation of protein amino acid phosphorylation; DNA-dependent DNA replication; cell cycle

Research Articles on CDK2AP1

Similar Products

Product Notes

The CDK2AP1 cdk2ap1 (Catalog #AAA3241239) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The CDK2AP1 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CDK2AP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CDK2AP1 cdk2ap1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LLAIIEELGK EIRPTYAGSK SAMERLKRGI IHARGLVREC LAETERNARS. It is sometimes possible for the material contained within the vial of "CDK2AP1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.