CCRL1 blocking peptide

CCRL1 Peptide - C-terminal region

Cat. Num. AAA3240379

• Gene Names: ACKR4; PPR1; CCBP2; CCR10; CCR11; CCRL1; VSHK1; CCR-11; CKR-11; CCX CKR; CCX-CKR; CC-CKR-11
• Reactivity: Human
• Applications: Western Blot
• Synonyms: CCRL1; CCRL1 Peptide - C-terminal region; CCRL1 blocking peptide

• Reactivity: Human
• Form/Format: Lyophilized powder
• Sequence: PILYVFMGASFKNYVMKVAKKYGSWRRQRQSVEEFPFDSEGPTEPTSTFS
• Sequence Length: 350

• Applicable Applications for CCRL1 blocking peptide: Western Blot (WB)
• Preparation and Storage: Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Related Product Information for CCRL1 blocking peptide

The protein encoded by this gene is a member of the G protein-coupled receptor family, and is a receptor for C-C type chemokines. This receptor has been shown to bind dendritic cell- and T cell-activated chemokines including CCL19/ELC, CCL21/SLC, and CCL25/TECK. Alternatively spliced transcript variants encoding the same protein have been described.

Product Categories/Family for CCRL1 blocking peptide

Peptide

NCBI and Uniprot Product Information

• NCBI GI #: 7706769
• NCBI GeneID: 51554
• NCBI Accession #: NP_057641
• NCBI GenBank Nucleotide #: NM_016557
• UniProt Accession #: Q9NPB9
• Molecular Weight: 39kDa
• NCBI Official Full Name: atypical chemokine receptor 4
• NCBI Official Synonym Full Names: atypical chemokine receptor 4
• NCBI Official Symbol: ACKR4
• NCBI Official Synonym Symbols: PPR1; CCBP2; CCR10; CCR11; CCRL1; VSHK1; CCR-11; CKR-11; CCX CKR; CCX-CKR; CC-CKR-11
• NCBI Protein Information: atypical chemokine receptor 4
• UniProt Protein Name: C-C chemokine receptor type 11
• UniProt Gene Name: CCRL1
• UniProt Synonym Gene Names: CCBP2; CCR11; VSHK1; C-C CKR-11; CC-CKR-11; CCR-11; CCRL1
• UniProt Entry Name: CCRL1_HUMAN

NCBI Description

The protein encoded by this gene is a member of the G protein-coupled receptor family, and is a receptor for C-C type chemokines. This receptor has been shown to bind dendritic cell- and T cell-activated chemokines including CCL19/ELC, CCL21/SLC, and CCL25/TECK. A pseudogene of this gene is found on chromosome 6. Alternatively spliced transcript variants encoding the same protein have been described. [provided by RefSeq, Jul 2013]

Uniprot Description

CCRL1: Receptor for CCL2, CCL8, CCL13, CCL19, CCL21 and CCL25. Belongs to the G-protein coupled receptor 1 family.

Protein type: Receptor, GPCR; GPCR, family 1; Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 3q22

Cellular Component: recycling endosome; integral to plasma membrane; early endosome; plasma membrane

Molecular Function: protein binding; chemokine receptor activity; chemokine binding; scavenger receptor activity

Biological Process: G-protein coupled receptor protein signaling pathway; receptor-mediated endocytosis; immune response; chemotaxis