Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CCRL1 AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole Cell)

Rabbit CCRL1 Polyclonal Antibody | anti-ACKR4 antibody

CCRL1 antibody - C-terminal region

Gene Names
ACKR4; PPR1; CCBP2; CCR10; CCR11; CCRL1; VSHK1; CCR-11; CKR-11; CCX CKR; CCX-CKR; CC-CKR-11
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CCRL1; Polyclonal Antibody; CCRL1 antibody - C-terminal region; anti-ACKR4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PILYVFMGASFKNYVMKVAKKYGSWRRQRQSVEEFPFDSEGPTEPTSTFS
Sequence Length
350
Applicable Applications for anti-ACKR4 antibody
Western Blot (WB)
Homology
Cow: 79%; Dog: 93%; Guinea Pig: 92%; Horse: 93%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 92%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CCRL1 AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole Cell)

Western Blot (WB) (WB Suggested Anti-CCRL1 AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole Cell)
Related Product Information for anti-ACKR4 antibody
This is a rabbit polyclonal antibody against CCRL1. It was validated on Western Blot

Target Description: The protein encoded by this gene is a member of the G protein-coupled receptor family, and is a receptor for C-C type chemokines. This receptor has been shown to bind dendritic cell- and T cell-activated chemokines including CCL19/ELC, CCL21/SLC, and CCL25/TECK. Alternatively spliced transcript variants encoding the same protein have been described.
Product Categories/Family for anti-ACKR4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
atypical chemokine receptor 4
NCBI Official Synonym Full Names
atypical chemokine receptor 4
NCBI Official Symbol
ACKR4
NCBI Official Synonym Symbols
PPR1; CCBP2; CCR10; CCR11; CCRL1; VSHK1; CCR-11; CKR-11; CCX CKR; CCX-CKR; CC-CKR-11
NCBI Protein Information
atypical chemokine receptor 4
UniProt Protein Name
C-C chemokine receptor type 11
UniProt Gene Name
CCRL1
UniProt Synonym Gene Names
CCBP2; CCR11; VSHK1; C-C CKR-11; CC-CKR-11; CCR-11; CCRL1
UniProt Entry Name
CCRL1_HUMAN

NCBI Description

The protein encoded by this gene is a member of the G protein-coupled receptor family, and is a receptor for C-C type chemokines. This receptor has been shown to bind dendritic cell- and T cell-activated chemokines including CCL19/ELC, CCL21/SLC, and CCL25/TECK. A pseudogene of this gene is found on chromosome 6. Alternatively spliced transcript variants encoding the same protein have been described. [provided by RefSeq, Jul 2013]

Uniprot Description

CCRL1: Receptor for CCL2, CCL8, CCL13, CCL19, CCL21 and CCL25. Belongs to the G-protein coupled receptor 1 family.

Protein type: Receptor, GPCR; GPCR, family 1; Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 3q22

Cellular Component: recycling endosome; integral to plasma membrane; early endosome; plasma membrane

Molecular Function: protein binding; chemokine receptor activity; chemokine binding; scavenger receptor activity

Biological Process: G-protein coupled receptor protein signaling pathway; receptor-mediated endocytosis; immune response; chemotaxis

Research Articles on ACKR4

Similar Products

Product Notes

The ACKR4 ccrl1 (Catalog #AAA3215476) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CCRL1 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CCRL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ACKR4 ccrl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PILYVFMGAS FKNYVMKVAK KYGSWRRQRQ SVEEFPFDSE GPTEPTSTFS. It is sometimes possible for the material contained within the vial of "CCRL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.