Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

CABLES1 blocking peptide

CABLES1 Peptide - C-terminal region

Gene Names
CABLES1; CABL1; IK3-1; CABLES; HsT2563
Reactivity
Human
Applications
Western Blot
Synonyms
CABLES1; CABLES1 Peptide - C-terminal region; CABLES1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
PSYMTTVIDYVKPSDLKKDMNETFKEKFPHIKLTLSKIRSLKREMRKLAQ
Sequence Length
368
Applicable Applications for CABLES1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for CABLES1 blocking peptide
This is a synthetic peptide designed for use in combination with anti-CABLES1 Antibody, made

Target Description: This gene encodes a protein involved in regulation of the cell cycle through interactions with several cyclin-dependent kinases. One study reported aberrant splicing of transcripts from this gene which results in removal of the cyclin binding domain only in human cancer cells, and reduction in gene expression was shown in colorectal cancers.Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for CABLES1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
CDK5 and ABL1 enzyme substrate 1 isoform 1
NCBI Official Synonym Full Names
Cdk5 and Abl enzyme substrate 1
NCBI Official Symbol
CABLES1
NCBI Official Synonym Symbols
CABL1; IK3-1; CABLES; HsT2563
NCBI Protein Information
CDK5 and ABL1 enzyme substrate 1
UniProt Protein Name
CDK5 and ABL1 enzyme substrate 1
UniProt Gene Name
CABLES1
UniProt Synonym Gene Names
CABLES; Ik3-1
UniProt Entry Name
CABL1_HUMAN

NCBI Description

This gene encodes a protein involved in regulation of the cell cycle through interactions with several cyclin-dependent kinases. One study (PMID: 16177568) reported aberrant splicing of transcripts from this gene which results in removal of the cyclin binding domain only in human cancer cells, and reduction in gene expression was shown in colorectal cancers (PMID: 17982127).Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2012]

Uniprot Description

CABLES1: Cyclin-dependent kinase binding protein. Enhances cyclin-dependent kinase tyrosine phosphorylation by nonreceptor tyrosine kinases, such as that of CDK5 by activated ABL1, which leads to increased CDK5 activity and is critical for neuronal development, and that of CDK2 by WEE1, which leads to decreased CDK2 activity and growth inhibition. Positively affects neuronal outgrowth. Plays a role as a regulator for p53/p73-induced cell death. Belongs to the cyclin family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 18q11.2

Cellular Component: cytosol; nucleus

Molecular Function: protein binding

Biological Process: nervous system development; cell division; blood coagulation; cell cycle

Research Articles on CABLES1

Similar Products

Product Notes

The CABLES1 cables1 (Catalog #AAA3241446) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The CABLES1 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CABLES1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CABLES1 cables1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PSYMTTVIDY VKPSDLKKDM NETFKEKFPH IKLTLSKIRS LKREMRKLAQ. It is sometimes possible for the material contained within the vial of "CABLES1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.