Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of CCR9 expression in transfected 293T cell line by CCR9 polyclonal antibody. Lane 1: CCR9 transfected lysate (42kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human CCR9 Polyclonal Antibody | anti-CCR9 antibody

CCR9 (C-C Chemokine Receptor Type 9, CC-CKR-9, C-C CKR-9, CCR-9, CDw199, GPR28, GPR-9-6, G-protein Coupled Receptor 28) APC

Gene Names
CCR9; GPR28; CDw199; GPR-9-6; CC-CKR-9
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CCR9; Polyclonal Antibody; CCR9 (C-C Chemokine Receptor Type 9; CC-CKR-9; C-C CKR-9; CCR-9; CDw199; GPR28; GPR-9-6; G-protein Coupled Receptor 28) APC; anti-CCR9 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CCR9.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
369
Applicable Applications for anti-CCR9 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human CCR9, aa1-369 (NP_112477.1).
Immunogen Sequence
MTPTDFTSPIPNMADDYGSESTSSMEDYVNFNFTDFYCEKNNVRQFASHFLPPLYWLVFIVGALGNSLVILVYWYCTRVKTMTDMFLLNLAIADLLFLVTLPFWAIAAADQWKFQTFMCKVVNSMYKMNFYSCVLLIMCISVDRYIAIAQAMRAHTWREKRLLYSKMVCFTIWVLAAALCIPEILYSQIKEESGIAICTMVYPSDESTKLKSAVLTLKVILGFFLPFVVMACCYTIIIHTLIQAKKSSKHKALKVTITVLTVFVLSQFPYNCILLVQTIDAYAMFISNCAVSTNIDICFQVTQTIAFFHSCLNPVLYVFVGERFRRDLVKTLKNLGCISQAQWVSFTRREGSLKLSSMLLETTSGALSL
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CCR9 expression in transfected 293T cell line by CCR9 polyclonal antibody. Lane 1: CCR9 transfected lysate (42kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CCR9 expression in transfected 293T cell line by CCR9 polyclonal antibody. Lane 1: CCR9 transfected lysate (42kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-CCR9 antibody
CKR9/CCR9 (C-C chemokine receptor type 9), also designated GPR-9-6, is a G protein-coupled, seven-transmembrane domain receptor protein. It has been found that CKR9/CCR9 is a receptor for the thymus expressed chemokine TECK. CKR9/CCR9 and TECK are thought to play a specialized role in the immune response because both are highly expressed by T lymphocytes in the small intestine, where they are not in other tissues.
Product Categories/Family for anti-CCR9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
C-C chemokine receptor type 9 isoform A
NCBI Official Synonym Full Names
C-C motif chemokine receptor 9
NCBI Official Symbol
CCR9
NCBI Official Synonym Symbols
GPR28; CDw199; GPR-9-6; CC-CKR-9
NCBI Protein Information
C-C chemokine receptor type 9
UniProt Protein Name
C-C chemokine receptor type 9
Protein Family
UniProt Gene Name
CCR9
UniProt Synonym Gene Names
GPR28; C-C CKR-9; CC-CKR-9; CCR-9
UniProt Entry Name
CCR9_HUMAN

NCBI Description

The protein encoded by this gene is a member of the beta chemokine receptor family. It is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. Chemokines and their receptors are key regulators of the thymocytes migration and maturation in normal and inflammation conditions. The specific ligand of this receptor is CCL25. It has been found that this gene is differentially expressed by T lymphocytes of small intestine and colon, suggested a role in the thymocytes recruitment and development that may permit functional specialization of immune responses in different segment of the gastrointestinal tract. This gene is mapped to the chemokine receptor gene cluster region. Two alternatively spliced transcript variants have been described. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2012]

Uniprot Description

CCR9: Receptor for chemokine SCYA25/TECK. Subsequently transduces a signal by increasing the intracellular calcium ions level. Alternative coreceptor with CD4 for HIV-1 infection. Belongs to the G-protein coupled receptor 1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Motility/polarity/chemotaxis; Receptor, GPCR; Membrane protein, multi-pass; GPCR, family 1

Chromosomal Location of Human Ortholog: 3p21.3

Cellular Component: cell surface; integral to plasma membrane; plasma membrane

Molecular Function: C-C chemokine receptor activity; chemokine receptor activity

Biological Process: G-protein coupled receptor protein signaling pathway; elevation of cytosolic calcium ion concentration; cellular defense response; immune response; chemotaxis

Research Articles on CCR9

Similar Products

Product Notes

The CCR9 ccr9 (Catalog #AAA6372686) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CCR9 (C-C Chemokine Receptor Type 9, CC-CKR-9, C-C CKR-9, CCR-9, CDw199, GPR28, GPR-9-6, G-protein Coupled Receptor 28) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CCR9 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CCR9 ccr9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CCR9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.