Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

BCAN blocking peptide

BCAN Peptide - middle region

Gene Names
BCAN; BEHAB; CSPG7
Reactivity
Human
Synonyms
BCAN; BCAN Peptide - middle region; BCAN blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: PIMEDGGGGSSTPEDPAEAPRTLLEFETQSMVPPTGFSEEEGKALEEEEK
Sequence Length
671
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for BCAN blocking peptide
This is a synthetic peptide designed for use in combination with anti- BCAN Antibody, made

Target Description: This gene encodes a member of the lectican family of chondroitin sulfate proteoglycans that is specifically expressed in the central nervous system. This protein is developmentally regulated and may function in the formation of the brain extracellular matrix. This protein is highly expressed in gliomas and may promote the growth and cell motility of brain tumor cells. Alternate splicing results in multiple transcript variants.
Product Categories/Family for BCAN blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
73 kDa
NCBI Official Full Name
brevican core protein isoform 1
NCBI Official Synonym Full Names
brevican
NCBI Official Symbol
BCAN
NCBI Official Synonym Symbols
BEHAB; CSPG7
NCBI Protein Information
brevican core protein
UniProt Protein Name
Brevican core protein
Protein Family
UniProt Gene Name
BCAN
UniProt Synonym Gene Names
BEHAB; CSPG7; BEHAB
UniProt Entry Name
PGCB_HUMAN

NCBI Description

This gene encodes a member of the lectican family of chondroitin sulfate proteoglycans that is specifically expressed in the central nervous system. This protein is developmentally regulated and may function in the formation of the brain extracellular matrix. This protein is highly expressed in gliomas and may promote the growth and cell motility of brain tumor cells. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2011]

Uniprot Description

BCAN: May play a role in the terminally differentiating and the adult nervous system during postnatal development. Could stabilize interactions between hyaluronan (HA) and brain proteoglycans. Belongs to the aggrecan/versican proteoglycan family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted, signal peptide; Membrane protein, GPI anchor; Secreted

Chromosomal Location of Human Ortholog: 1q31

Cellular Component: proteinaceous extracellular matrix; lysosomal lumen; Golgi lumen; extracellular region

Molecular Function: extracellular matrix structural constituent; hyaluronic acid binding; carbohydrate binding

Biological Process: chondroitin sulfate metabolic process; extracellular matrix disassembly; extracellular matrix organization and biogenesis; chondroitin sulfate biosynthetic process; central nervous system development; glycosaminoglycan metabolic process; chondroitin sulfate catabolic process; hippocampus development; carbohydrate metabolic process; pathogenesis; cell adhesion; skeletal development; dermatan sulfate biosynthetic process

Research Articles on BCAN

Similar Products

Product Notes

The BCAN bcan (Catalog #AAA3246380) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The BCAN Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: PIMEDGGGGS STPEDPAEAP RTLLEFETQS MVPPTGFSEE EGKALEEEEK. It is sometimes possible for the material contained within the vial of "BCAN, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.