Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

ASNA1 blocking peptide

ASNA1 Peptide - C-terminal region

Gene Names
ASNA1; GET3; ARSA1; TRC40; ARSA-I; ASNA-I
Reactivity
Human
Applications
Western Blot
Synonyms
ASNA1; ASNA1 Peptide - C-terminal region; ASNA1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
LASKLEETLPVIRSVSEQFKDPEQTTFICVCIAEFLSLYETERLIQELAK
Sequence Length
348
Applicable Applications for ASNA1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for ASNA1 blocking peptide
This is a synthetic peptide designed for use in combination with anti-ASNA1 Antibody, made

Target Description: ASNA1 is the human homolog of the bacterial arsA gene. In E. coli, ArsA ATPase is the catalytic component of a multisubunit oxyanion pump that is responsible for resistance to arsenicals and antimonials.
Product Categories/Family for ASNA1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
439
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
ATPase ASNA1
NCBI Official Synonym Full Names
arsA arsenite transporter, ATP-binding, homolog 1 (bacterial)
NCBI Official Symbol
ASNA1
NCBI Official Synonym Symbols
GET3; ARSA1; TRC40; ARSA-I; ASNA-I
NCBI Protein Information
ATPase ASNA1
UniProt Protein Name
ATPase ASNA1
Protein Family
UniProt Gene Name
ASNA1
UniProt Entry Name
ASNA_HUMAN

NCBI Description

This gene represents the human homolog of the bacterial arsA gene, encoding the arsenite-stimulated ATPase component of the arsenite transporter responsible for resistance to arsenicals. This protein is also a central component of a transmembrane domain (TMD) recognition complex (TRC) that is involved in the post-translational delivery of tail-anchored (TA) proteins from the cytosol to the endoplasmic reticulum (ER). It recognizes and selectively binds the TMD of TA proteins in the cytosol, and delivers them to the ER for insertion. [provided by RefSeq, Oct 2011]

Uniprot Description

ASNA1: ATPase required for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum. Recognizes and selectively binds the transmembrane domain of TA proteins in the cytosol. This complex then targets to the endoplasmic reticulum by membrane-bound receptors, where the tail- anchored protein is released for insertion. This process is regulated by ATP binding and hydrolysis. ATP binding drives the homodimer towards the closed dimer state, facilitating recognition of newly synthesized TA membrane proteins. ATP hydolysis is required for insertion. Subsequently, the homodimer reverts towards the open dimer state, lowering its affinity for the membrane-bound receptor, and returning it to the cytosol to initiate a new round of targeting. May be involved in insulin signaling. Belongs to the arsA ATPase family.

Protein type: Nucleolus; EC 3.6.-.-; EC 3.6.3.16; Hydrolase

Chromosomal Location of Human Ortholog: 19q13.3

Cellular Component: endoplasmic reticulum; cytoplasm; nucleolus; nucleus

Molecular Function: arsenite transmembrane transporter activity; transporter activity; metal ion binding; ATPase activity; ATP binding

Biological Process: protein insertion into ER membrane; transport; metabolic process; inorganic anion transport

Research Articles on ASNA1

Similar Products

Product Notes

The ASNA1 asna1 (Catalog #AAA3239635) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The ASNA1 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ASNA1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ASNA1 asna1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LASKLEETLP VIRSVSEQFK DPEQTTFICV CIAEFLSLYE TERLIQELAK. It is sometimes possible for the material contained within the vial of "ASNA1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.