Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

ARHGEF3 blocking peptide

ARHGEF3 Peptide - N-terminal region

Gene Names
ARHGEF3; GEF3; STA3; XPLN
Reactivity
Human
Synonyms
ARHGEF3; ARHGEF3 Peptide - N-terminal region; ARHGEF3 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: VKPLSRVTSLANLIPPVKATPLKRFSQTLQRSISFRSESRPDILAPRPWS
Sequence Length
526
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for ARHGEF3 blocking peptide
Rho-like GTPases are involved in a variety of cellular processes, and they are activated by binding GTP and inactivated by conversion of GTP to GDP by their intrinsic GTPase activity. Guanine nucleotide exchange factors (GEFs) accelerate the GTPase activity of Rho GTPases by catalyzing their release of bound GDP. This gene encodes a guanine nucleotide exchange factor, which specifically activates two members of the Rho GTPase family: RHOA and RHOB, both of which have a role in bone cell biology. It has been identified that genetic variation in this gene plays a role in the determination of bone mineral density (BMD), indicating the implication of this gene in postmenopausal osteoporosis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for ARHGEF3 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57kDa
NCBI Official Full Name
rho guanine nucleotide exchange factor 3 isoform 1
NCBI Official Synonym Full Names
Rho guanine nucleotide exchange factor 3
NCBI Official Symbol
ARHGEF3
NCBI Official Synonym Symbols
GEF3; STA3; XPLN
NCBI Protein Information
rho guanine nucleotide exchange factor 3
UniProt Protein Name
Rho guanine nucleotide exchange factor 3
UniProt Gene Name
ARHGEF3
UniProt Synonym Gene Names
XPLN
UniProt Entry Name
ARHG3_HUMAN

NCBI Description

Rho-like GTPases are involved in a variety of cellular processes, and they are activated by binding GTP and inactivated by conversion of GTP to GDP by their intrinsic GTPase activity. Guanine nucleotide exchange factors (GEFs) accelerate the GTPase activity of Rho GTPases by catalyzing their release of bound GDP. This gene encodes a guanine nucleotide exchange factor, which specifically activates two members of the Rho GTPase family: RHOA and RHOB, both of which have a role in bone cell biology. It has been identified that genetic variation in this gene plays a role in the determination of bone mineral density (BMD), indicating the implication of this gene in postmenopausal osteoporosis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

ARHGEF3: Acts as guanine nucleotide exchange factor (GEF) for RhoA and RhoB GTPases. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: GAPs, Rac/Rho; Motility/polarity/chemotaxis; GAPs

Chromosomal Location of Human Ortholog: 3p14.3

Cellular Component: intracellular; cytosol

Molecular Function: Rho guanyl-nucleotide exchange factor activity

Biological Process: regulation of small GTPase mediated signal transduction; nerve growth factor receptor signaling pathway; positive regulation of apoptosis; small GTPase mediated signal transduction; Rho protein signal transduction

Research Articles on ARHGEF3

Similar Products

Product Notes

The ARHGEF3 arhgef3 (Catalog #AAA3238253) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The ARHGEF3 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: VKPLSRVTSL ANLIPPVKAT PLKRFSQTLQ RSISFRSESR PDILAPRPWS. It is sometimes possible for the material contained within the vial of "ARHGEF3, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.