Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

ADGRL3 blocking peptide

ADGRL3 Peptide - middle region

Gene Names
ADGRL3; CL3; LEC3; CIRL3; LPHN3
Reactivity
Human
Synonyms
ADGRL3; ADGRL3 Peptide - middle region; ADGRL3 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: DGALFFNKERTRNIVKFDLRTRIKSGEAIIANANYHDTSPYRWGGKSDID
Sequence Length
707
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for ADGRL3 blocking peptide
This gene encodes a member of the latrophilin subfamily of G-protein coupled receptors (GPCR). Latrophilins may function in both cell adhesion and signal transduction. In experiments with non-human species, endogenous proteolytic cleavage within a cysteine-rich GPS (G-protein-coupled-receptor proteolysis site) domain resulted in two subunits (a large extracellular N-terminal cell adhesion subunit and a subunit with substantial similarity to the secretin/calcitonin family of GPCRs) being non-covalently bound at the cell membrane.
Product Categories/Family for ADGRL3 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
77 kDa
NCBI Official Full Name
adhesion G protein-coupled receptor L3 isoform 2
NCBI Official Synonym Full Names
adhesion G protein-coupled receptor L3
NCBI Official Symbol
ADGRL3
NCBI Official Synonym Symbols
CL3; LEC3; CIRL3; LPHN3
NCBI Protein Information
adhesion G protein-coupled receptor L3
UniProt Protein Name
Latrophilin-3
UniProt Gene Name
LPHN3
UniProt Synonym Gene Names
KIAA0768; LEC3; CIRL-3
UniProt Entry Name
LPHN3_HUMAN

NCBI Description

This gene encodes a member of the latrophilin subfamily of G-protein coupled receptors (GPCR). Latrophilins may function in both cell adhesion and signal transduction. In experiments with non-human species, endogenous proteolytic cleavage within a cysteine-rich GPS (G-protein-coupled-receptor proteolysis site) domain resulted in two subunits (a large extracellular N-terminal cell adhesion subunit and a subunit with substantial similarity to the secretin/calcitonin family of GPCRs) being non-covalently bound at the cell membrane. [provided by RefSeq, Jul 2008]

Uniprot Description

latrophilin 3: a member of the latrophilin subfamily of G-protein coupled receptors (GPCR). Latrophilins may function in both cell adhesion and signal transduction. In experiments with non-human species, endogenous proteolytic cleavage within a cysteine-rich GPS (G-protein-coupled-receptor proteolysis site) domain resulted in two subunits (a large extracellular N-terminal cell adhesion subunit and a subunit with substantial similarity to the secretin/calcitonin family of GPCRs) being non-covalently bound at the cell membrane. [provided by RefSeq, Jul 2008]

Protein type: Membrane protein, multi-pass; GPCR, family 2; Receptor, GPCR; Membrane protein, integral

Chromosomal Location of Human Ortholog: 4q13.1

Cellular Component: integral to membrane; plasma membrane

Molecular Function: G-protein coupled receptor activity; carbohydrate binding

Biological Process: G-protein coupled receptor protein signaling pathway

Research Articles on ADGRL3

Similar Products

Product Notes

The ADGRL3 lphn3 (Catalog #AAA3247240) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The ADGRL3 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: DGALFFNKER TRNIVKFDLR TRIKSGEAII ANANYHDTSP YRWGGKSDID. It is sometimes possible for the material contained within the vial of "ADGRL3, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.