Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

ACE blocking peptide

ACE Peptide - N-terminal region

Gene Names
ACE; DCP; ACE1; DCP1; CD143
Reactivity
Human
Applications
Western Blot
Synonyms
ACE; ACE Peptide - N-terminal region; ACE blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: KPLYEDFTALSNEAYKQDGFTDTGAYWRSWYNSPTFEDDLEHLYQQLEPL
Sequence Length
1145
Applicable Applications for ACE blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for ACE blocking peptide
This is a synthetic peptide designed for use in combination with anti-ACE Antibody, made

Target Description: This gene encodes an enzyme involved in catalyzing the conversion of angiotensin I into a physiologically active peptide angiotensin II. Angiotensin II is a potent vasopressor and aldosterone-stimulating peptide that controls blood pressure and fluid-electrolyte balance. This enzyme plays a key role in the renin-angiotensin system. Many studies have associated the presence or absence of a 287 bp Alu repeat element in this gene with the levels of circulating enzyme or cardiovascular pathophysiologies. Multiple alternatively spliced transcript variants encoding different isoforms have been identified, and two most abundant spliced variants encode the somatic form and the testicular form, respectively, that are equally active.
Product Categories/Family for ACE blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
125 kDa
NCBI Official Full Name
angiotensin-converting enzyme isoform 1
NCBI Official Synonym Full Names
angiotensin I converting enzyme
NCBI Official Symbol
ACE
NCBI Official Synonym Symbols
DCP; ACE1; DCP1; CD143
NCBI Protein Information
angiotensin-converting enzyme
UniProt Protein Name
Angiotensin-converting enzyme
Protein Family
UniProt Gene Name
ACE
UniProt Synonym Gene Names
DCP; DCP1; ACE
UniProt Entry Name
ACE_HUMAN

NCBI Description

This gene encodes an enzyme involved in catalyzing the conversion of angiotensin I into a physiologically active peptide angiotensin II. Angiotensin II is a potent vasopressor and aldosterone-stimulating peptide that controls blood pressure and fluid-electrolyte balance. This enzyme plays a key role in the renin-angiotensin system. Many studies have associated the presence or absence of a 287 bp Alu repeat element in this gene with the levels of circulating enzyme or cardiovascular pathophysiologies. Multiple alternatively spliced transcript variants encoding different isoforms have been identified, and two most abundant spliced variants encode the somatic form and the testicular form, respectively, that are equally active. [provided by RefSeq, May 2010]

Uniprot Description

ACE: Converts angiotensin I to angiotensin II by release of the terminal His-Leu, this results in an increase of the vasoconstrictor activity of angiotensin. Also able to inactivate bradykinin, a potent vasodilator. Has also a glycosidase activity which releases GPI-anchored proteins from the membrane by cleaving the mannose linkage in the GPI moiety. Genetic variations in ACE may be a cause of susceptibility to ischemic stroke (ISCHSTR); also known as cerebrovascular accident or cerebral infarction. A stroke is an acute neurologic event leading to death of neural tissue of the brain and resulting in loss of motor, sensory and/or cognitive function. Ischemic strokes, resulting from vascular occlusion, is considered to be a highly complex disease consisting of a group of heterogeneous disorders with multiple genetic and environmental risk factors. Defects in ACE are a cause of renal tubular dysgenesis (RTD). RTD is an autosomal recessive severe disorder of renal tubular development characterized by persistent fetal anuria and perinatal death, probably due to pulmonary hypoplasia from early-onset oligohydramnios (the Potter phenotype). Genetic variations in ACE are associated with susceptibility to microvascular complications of diabetes type 3 (MVCD3). These are pathological conditions that develop in numerous tissues and organs as a consequence of diabetes mellitus. They include diabetic retinopathy, diabetic nephropathy leading to end-stage renal disease, and diabetic neuropathy. Diabetic retinopathy remains the major cause of new- onset blindness among diabetic adults. It is characterized by vascular permeability and increased tissue ischemia and angiogenesis. Defects in ACE are a cause of susceptibility to intracerebral hemorrhage (ICH). A pathological condition characterized by bleeding into one or both cerebral hemispheres including the basal ganglia and the cerebral cortex. It is often associated with hypertension and craniocerebral trauma. Intracerebral bleeding is a common cause of stroke. Belongs to the peptidase M2 family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Protease; Membrane protein, integral; EC 3.4.15.1

Chromosomal Location of Human Ortholog: 17q23.3

Cellular Component: extracellular space; lysosome; extracellular region; integral to membrane; plasma membrane; endosome; external side of plasma membrane

Molecular Function: peptidyl-dipeptidase activity; tripeptidyl-peptidase activity; metallopeptidase activity; zinc ion binding; carboxypeptidase activity; mitogen-activated protein kinase kinase binding; drug binding; actin binding; protein binding; bradykinin receptor binding; endopeptidase activity; exopeptidase activity; mitogen-activated protein kinase binding; chloride ion binding

Biological Process: mononuclear cell proliferation; regulation of vasodilation; neutrophil mediated immunity; angiotensin mediated regulation of renal output; regulation of angiotensin metabolic process; arachidonic acid secretion; proteolysis; angiotensin maturation; regulation of systemic arterial blood pressure by renin-angiotensin; antigen processing and presentation of peptide antigen via MHC class I; cellular protein metabolic process; regulation of smooth muscle cell migration; heart contraction; peptide catabolic process; regulation of vasoconstriction; beta-amyloid metabolic process; regulation of blood pressure; angiotensin catabolic process in blood; blood vessel remodeling; hormone catabolic process; spermatogenesis; kidney development

Disease: Renal Tubular Dysgenesis; Microvascular Complications Of Diabetes, Susceptibility To, 3; Alzheimer Disease; Hemorrhage, Intracerebral, Susceptibility To

Research Articles on ACE

Similar Products

Product Notes

The ACE ace (Catalog #AAA3239624) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The ACE Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ACE can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ACE ace for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KPLYEDFTAL SNEAYKQDGF TDTGAYWRSW YNSPTFEDDL EHLYQQLEPL. It is sometimes possible for the material contained within the vial of "ACE, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.