Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

AATK blocking peptide

AATK Peptide - C-terminal region

Gene Names
AATK; LMR1; AATYK; LMTK1; p35BP; AATYK1; PPP1R77
Reactivity
Human
Applications
Western Blot
Synonyms
AATK; AATK Peptide - C-terminal region; AATK blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: APNRPQQADGSPNGSTAEEGGGFAWDDDFPLMTAKAAFAMALDPAAPAPA
Sequence Length
1374
Applicable Applications for AATK blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for AATK blocking peptide
This is a synthetic peptide designed for use in combination with anti-AATK Antibody, made

Target Description: The protein encoded by this gene contains a tyrosine kinase domain at the N-terminus and a proline-rich domain at the C-terminus. This gene is induced during apoptosis, and expression of this gene may be a necessary pre-requisite for the induction of growth arrest and/or apoptosis of myeloid precursor cells. This gene has been shown to produce neuronal differentiation in a neuroblastoma cell line. Two transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for AATK blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
151kDa
NCBI Official Full Name
AATK protein, partial
NCBI Official Synonym Full Names
apoptosis associated tyrosine kinase
NCBI Official Symbol
AATK
NCBI Official Synonym Symbols
LMR1; AATYK; LMTK1; p35BP; AATYK1; PPP1R77
NCBI Protein Information
serine/threonine-protein kinase LMTK1
UniProt Protein Name
Serine/threonine-protein kinase LMTK1
UniProt Gene Name
AATK
UniProt Synonym Gene Names
AATYK; KIAA0641; LMR1; LMTK1; AATYK; p35BP
UniProt Entry Name
LMTK1_HUMAN

NCBI Description

The protein encoded by this gene contains a tyrosine kinase domain at the N-terminus and a proline-rich domain at the C-terminus. This gene is induced during apoptosis, and expression of this gene may be a necessary pre-requisite for the induction of growth arrest and/or apoptosis of myeloid precursor cells. This gene has been shown to produce neuronal differentiation in a neuroblastoma cell line. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2011]

Uniprot Description

Lmr1: a protein kinase kinase of the Lmr family. Predominantly expressed in the nervous system and is involved in neurite extension and apoptosis of cerebellar granule cells. Contains a tyrosine kinase domain at the N-terminal end and a proline-rich domain at the C-terminal end. May be necessary for the induction of growth arrest and/or apoptosis of myeloid cells induced by cytokine withdrawal, such as IL3, and during G-CSF-induced terminal differentiation of myeloblasts to granulocytes. Four alternatively spliced isoforms have been reported.

Protein type: Protein kinase, TK; Protein kinase, tyrosine (receptor); EC 2.7.11.1; Membrane protein, integral; Kinase, protein; TK group; Lmr family

Chromosomal Location of Human Ortholog: 17q25.3

Cellular Component: recycling endosome; perinuclear region of cytoplasm; endoplasmic reticulum; integral to membrane

Molecular Function: protein serine/threonine kinase activity; protein binding; protein-tyrosine kinase activity; ATP binding

Biological Process: neuron apoptosis; negative regulation of axon extension; brain development; Rab protein signal transduction

Research Articles on AATK

Similar Products

Product Notes

The AATK aatk (Catalog #AAA3244280) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The AATK Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AATK can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the AATK aatk for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: APNRPQQADG SPNGSTAEEG GGFAWDDDFP LMTAKAAFAM ALDPAAPAPA. It is sometimes possible for the material contained within the vial of "AATK, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.