Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

5-hydroxytryptamine receptor 3B (HTR3B) Recombinant Protein | HTR3B recombinant protein

Recombinant Human 5-hydroxytryptamine receptor 3B (HTR3B)

Gene Names
HTR3B; 5-HT3B
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
5-hydroxytryptamine receptor 3B (HTR3B); Recombinant Human 5-hydroxytryptamine receptor 3B (HTR3B); Recombinant 5-hydroxytryptamine receptor 3B (HTR3B); 5-hydroxytryptamine receptor 3B; 5-HT3-B; 5-HT3B; Serotonin receptor 3B; HTR3B recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
22-441
Sequence
TDTHHPQDSALYHLSKQLLQKYHKEVRPVYNWTKATTVYLDLFVHAILDVDAENQILKTSVWYQEVWNDEFLSWNSSMFDEIREISLPLSAIWAPDIIINEFVDIERYPDLPYVYVNSSGTIENYKPIQVVSACSLETYAFPFDVQNCSLTFKSILHTVEDVDLAFLRSPEDIQHDKKAFLNDSEWELLSVSSTYSILQSSAGGFAQIQFNVVMRRHPLVYVVSLLIPSIFLMLVDLGSFYLPPNCRARIVFKTSVLVGYTVFRVNMSNQVPRSVGSTPLIGHFFTICMAFLVLSLAKSIVLVKFLHDEQRGGQEQPFLCLRGDTDADRPRVEPRAQRAVVTESSLYGEHLAQPGTLKEVWSQLQSISNYLQTQDQTDQQEAEWLVLLSRFDRLLFQSYLFMLGIYTITLCSLWALWGGV
Sequence Length
441
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50,292 Da
NCBI Official Full Name
5-hydroxytryptamine receptor 3B
NCBI Official Synonym Full Names
5-hydroxytryptamine (serotonin) receptor 3B, ionotropic
NCBI Official Symbol
HTR3B
NCBI Official Synonym Symbols
5-HT3B
NCBI Protein Information
5-hydroxytryptamine receptor 3B; 5-HT3-B; serotonin-gated ion channel subunit; 5-hydroxytryptamine 3 receptor B subunit
UniProt Protein Name
5-hydroxytryptamine receptor 3B
UniProt Gene Name
HTR3B
UniProt Synonym Gene Names
5-HT3-B; 5-HT3B
UniProt Entry Name
5HT3B_HUMAN

NCBI Description

The product of this gene belongs to the ligand-gated ion channel receptor superfamily. This gene encodes subunit B of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor causes fast, depolarizing responses in neurons after activation. It is not functional as a homomeric complex, but a pentaheteromeric complex with subunit A (HTR3A) displays the full functional features of this receptor. [provided by RefSeq, Aug 2011]

Uniprot Description

5-HT(3B): This is one of the several different receptors for 5- hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor is a ligand-gated ion channel, which when activated causes fast, depolarizing responses. It is a cation-specific, but otherwise relatively nonselective, ion channel. Belongs to the ligand-gated ion channel (TC 1.A.9) family. 5-hydroxytryptamine receptor (TC 1.A.9.2) subfamily. HTR3B sub-subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; Membrane protein, integral; Channel, cation; Channel, ligand-gated; Transporter, ion channel

Chromosomal Location of Human Ortholog: 11q23.1

Cellular Component: postsynaptic membrane; integral to plasma membrane; plasma membrane

Molecular Function: serotonin-activated cation-selective channel activity; serotonin receptor activity; ion channel activity

Biological Process: synaptic transmission; transport; transmembrane transport; serotonin receptor signaling pathway

Research Articles on HTR3B

Similar Products

Product Notes

The HTR3B htr3b (Catalog #AAA1152532) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 22-441. The amino acid sequence is listed below: TDTHHPQDSA LYHLSKQLLQ KYHKEVRPVY NWTKATTVYL DLFVHAILDV DAENQILKTS VWYQEVWNDE FLSWNSSMFD EIREISLPLS AIWAPDIIIN EFVDIERYPD LPYVYVNSSG TIENYKPIQV VSACSLETYA FPFDVQNCSL TFKSILHTVE DVDLAFLRSP EDIQHDKKAF LNDSEWELLS VSSTYSILQS SAGGFAQIQF NVVMRRHPLV YVVSLLIPSI FLMLVDLGSF YLPPNCRARI VFKTSVLVGY TVFRVNMSNQ VPRSVGSTPL IGHFFTICMA FLVLSLAKSI VLVKFLHDEQ RGGQEQPFLC LRGDTDADRP RVEPRAQRAV VTESSLYGEH LAQPGTLKEV WSQLQSISNY LQTQDQTDQQ EAEWLVLLSR FDRLLFQSYL FMLGIYTITL CSLWALWGGV. It is sometimes possible for the material contained within the vial of "5-hydroxytryptamine receptor 3B (HTR3B), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.