Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

5-hydroxytryptamine receptor 2C (Htr2c) Recombinant Protein | Htr2c recombinant protein

Recombinant Rat 5-hydroxytryptamine receptor 2C (Htr2c)

Gene Names
Htr2c; 5-HT2C; 5HT-1C; 5-HTR2C
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
5-hydroxytryptamine receptor 2C (Htr2c); Recombinant Rat 5-hydroxytryptamine receptor 2C (Htr2c); Htr2c recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-460aa; Full length protein
Sequence
MVNLGNAVRSLLMHLIGLLVWQFDISISPVAAIVTDTFNSSDGGRLFQFPDGVQNWPALS IVVIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYV WPLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVW AISIGVSVPIPVIGLRDESKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYFLTIY VLRRQTLMLLRGHTEEELANMSLNFLNCCCKKNGGEEENAPNPNPDQKPRRKKKEKRPRG TMQAINNEKKASKVLGIVFFVFLIMWCPFFITNILSVLCGKACNQKLMEKLLNVFVWIGY VCSGINPLVYTLFNKIYRRAFSKYLRCDYKPDKKPPVRQIPRVAATALSGRELNVNIYRH TNERVARKANDPEPGIEMQVENLELPVNPSNVVSERISSV
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Rat
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Htr2c recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51,917 Da
NCBI Official Full Name
5-hydroxytryptamine receptor 2C
NCBI Official Synonym Full Names
5-hydroxytryptamine receptor 2C
NCBI Official Symbol
Htr2c
NCBI Official Synonym Symbols
5-HT2C; 5HT-1C; 5-HTR2C
NCBI Protein Information
5-hydroxytryptamine receptor 2C
UniProt Protein Name
5-hydroxytryptamine receptor 2C
UniProt Gene Name
Htr2c
UniProt Synonym Gene Names
5ht1c; Htr1c; 5-HT-2C; 5-HT2C; 5-HTR2C; 5-HT-1C; 5-HT1C
UniProt Entry Name
5HT2C_RAT

NCBI Description

Serotonin (5-hydroxytryptamine, 5-HT), a neurotransmitter, elicits a wide array of physiological effects by binding to several receptor subtypes, including the 5-HT2 family of seven-transmembrane-spanning, G-protein-coupled receptors, which activate phospholipase C and D signaling pathways. This gene encodes the 2C subtype of serotonin receptor and its mRNA is subject to multiple RNA editing events, where genomically encoded adenosine residues are converted to inosines. RNA editing is predicted to alter amino acids within the second intracellular loop of the 5-HT2C receptor and generate receptor isoforms that differ in their ability to interact with G proteins and the activation of phospholipase C and D signaling cascades, thus modulating serotonergic neurotransmission in the central nervous system. Studies in rodents show altered patterns of RNA editing in response to drug treatments and stressful situations. [provided by RefSeq, Jul 2008]

Uniprot Description

5-HT(2C): a G-protein coupled receptor. One of several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. Mediates its action by activating a phosphatidylinositol-calcium second messenger system.

Protein type: Membrane protein, multi-pass; Membrane protein, integral; Receptor, GPCR; GPCR, family 1

Cellular Component: cell surface; cytosol; external side of plasma membrane; integral to plasma membrane; intracellular; plasma membrane

Molecular Function: 5-HT2 receptor activity; drug binding; protein binding; serotonin binding; serotonin receptor activity

Biological Process: behavioral fear response; behavioral response to nicotine; cellular calcium ion homeostasis; cGMP biosynthetic process; elevation of cytosolic calcium ion concentration during G-protein signaling, coupled to IP3 second messenger (phospholipase C activating); feeding behavior; G-protein signaling, coupled to cyclic nucleotide second messenger; G-protein signaling, coupled to IP3 second messenger (phospholipase C activating); G-protein signaling, phospholipase D activating pathway; inositol phosphate-mediated signaling; locomotory behavior; negative regulation of dopamine metabolic process; negative regulation of locomotion; organ regeneration; positive regulation of acetylcholine secretion; positive regulation of fat cell differentiation; positive regulation of gamma-aminobutyric acid secretion; positive regulation of phosphatidylinositol biosynthetic process; positive regulation of vasoconstriction; regulation of appetite; regulation of corticotropin-releasing hormone secretion; regulation of neurological process; regulation of sensory perception of pain; release of sequestered calcium ion into cytosol; response to drug; serotonin receptor signaling pathway; serotonin receptor, phospholipase C activating pathway

Research Articles on Htr2c

Similar Products

Product Notes

The Htr2c htr2c (Catalog #AAA7017295) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-460aa; Full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Htr2c htr2c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MVNLGNAVRS LLMHLIGLLV WQFDISISPV AAIVTDTFNS SDGGRLFQFP DGVQNWPALS IVVIIIMTIG GNILVIMAVS MEKKLHNATN YFLMSLAIAD MLVGLLVMPL SLLAILYDYV WPLPRYLCPV WISLDVLFST ASIMHLCAIS LDRYVAIRNP IEHSRFNSRT KAIMKIAIVW AISIGVSVPI PVIGLRDESK VFVNNTTCVL NDPNFVLIGS FVAFFIPLTI MVITYFLTIY VLRRQTLMLL RGHTEEELAN MSLNFLNCCC KKNGGEEENA PNPNPDQKPR RKKKEKRPRG TMQAINNEKK ASKVLGIVFF VFLIMWCPFF ITNILSVLCG KACNQKLMEK LLNVFVWIGY VCSGINPLVY TLFNKIYRRA FSKYLRCDYK PDKKPPVRQI PRVAATALSG RELNVNIYRH TNERVARKAN DPEPGIEMQV ENLELPVNPS NVVSERISSV. It is sometimes possible for the material contained within the vial of "5-hydroxytryptamine receptor 2C (Htr2c), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.