Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

5-hydroxytryptamine receptor 2A (HTR2A) Recombinant Protein | HTR2A recombinant protein

Recombinant Guinea pig 5-hydroxytryptamine receptor 2A (HTR2A)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
5-hydroxytryptamine receptor 2A (HTR2A); Recombinant Guinea pig 5-hydroxytryptamine receptor 2A (HTR2A); Recombinant 5-hydroxytryptamine receptor 2A (HTR2A); 5-hydroxytryptamine receptor 2A; 5-HT-2; 5-HT-2A; Serotonin receptor 2A; HTR2A recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-247
Sequence
KLCAIWIYLDVLFSTASIMHLCAISLDRYVAIQNPIHHSRFNSRTKAFLKIIAVWTISVGISMPVPVFGLQDDSKVFKEGSCLLADDNFVLIGSFVAFFIPLTIMVITYFLTIKSLQKEATLCVSDPGTRAKLSSFSFLPQSSLSSEKLFQRSIHRETGSYAGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFVTNIMAVICKESCNEDVIGALLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFA
Sequence Length
247
Species
Cavia porcellus (Guinea pig)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
27,698 Da
NCBI Official Full Name
5-hydroxytryptamine receptor 2A
UniProt Protein Name
5-hydroxytryptamine receptor 2A
UniProt Gene Name
HTR2A
UniProt Synonym Gene Names
5-HT-2; 5-HT-2A
UniProt Entry Name
5HT2A_CAVPO

Uniprot Description

Function: This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. This receptor is involved in tracheal smooth muscle contraction, bronchoconstriction, and control of aldosterone production.

Subunit structure: Interacts with MPDZ and INADL. May interact with MPP3, PRDX6, DLG4, DLG1, CASK, APBA1 and MAGI2

By similarity.

Subcellular location: Cell membrane; Multi-pass membrane protein

By similarity. Note: Localizes to the postsynaptic thickening of axo-dendritic synapses

By similarity.

Sequence similarities: Belongs to the G-protein coupled receptor 1 family.

Similar Products

Product Notes

The 5-hydroxytryptamine receptor 2A (HTR2A) htr2a (Catalog #AAA964280) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-247. The amino acid sequence is listed below: KLCAIWIYLD VLFSTASIMH LCAISLDRYV AIQNPIHHSR FNSRTKAFLK IIAVWTISVG ISMPVPVFGL QDDSKVFKEG SCLLADDNFV LIGSFVAFFI PLTIMVITYF LTIKSLQKEA TLCVSDPGTR AKLSSFSFLP QSSLSSEKLF QRSIHRETGS YAGRRTMQSI SNEQKACKVL GIVFFLFVVM WCPFFVTNIM AVICKESCNE DVIGALLNVF VWIGYLSSAV NPLVYTLFNK TYRSAFA. It is sometimes possible for the material contained within the vial of "5-hydroxytryptamine receptor 2A (HTR2A), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.